lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.sk.po

# translation of lazaruside.po to Slovenský
# Slavko <slavino@slavino.sk>, 2008.
msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2007-12-26 15:21+0100\n"
"PO-Revision-Date: 2008-11-16 19:20+0100\n"
"Last-Translator: Slavko <slavino@slavino.sk>\n"
"Language-Team: Slovenský <sk@li.org>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: KBabel 1.11.4\n"
"Plural-Forms:  nplurals=3; plural=(n==1) ? 0 : (n>=2 && n<=4) ? 1 : 2;\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Všeobecné"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Len na čítanie"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Malé písmená, prvé veľké"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Pridať operátor priradenia (:=)"

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Globálne"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Riadok"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Ďalšia cesta zdrojových kódov pre všetky projekty (.pp;.pas)"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Pridať bodkočiarku"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Prispôsobiť horný riadok pre komentár vpredu"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Všetky súbory"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Podľa abecedy"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Kurozr vždy viditeľný"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nejednoznačná akcia súboru:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Upozorniť pri preklade"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Nastavenia aplikácie"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Predvolené"

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Zahrnúť kód asertion"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automaticky vytvárané formuláre:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Nový formulár pridať k automaticky vytváraným formulárom"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Auto zmazanie súboru"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr ""

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr ""

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Automaticky na malé písmená"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automatické ukladanie"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Dostupné formuláre:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Pozadie"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(bez podadresárov)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Rovnaké meno (v podadresári)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Za metódy"

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr ""

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Odsadenie bloku"

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Kompatibilné TP/BP 7.0"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr ""

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Použiť"

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "&Citlivé na veľkosť"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Skontrolovať voľby prekladača"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Výsledky"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Kontrola prekladača ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Kontrola nastavenia prekladača ..."

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Test: Kontrola nastavení fpc"

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Kontrola dát prekladača ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Preklad prázdneho súboru ..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Kontrola chýbajúcich ppu fpc"

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Kontrola zdrojových kódov v ceste fpc ppu"

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Preklad prázdneho súboru"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Poradie tried"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Posledný"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "malé písmená"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Ukážka (Maximálna dĺžka riadka = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Predpona čítania"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Prípona pre uložené"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "VEĽKÉ PÍSMENÁ"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Predpona premennej"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Predpona zápisu"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Kurzor do stredu riadka"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Uložiť ako - automaticky na malé písmená"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Skontrolovať správnosť"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Zvoľte súbor šablón kódu (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Pravidlá vkladania časti Class"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Zobraziť zatváracie tlačítka v poznámkovom bloku"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Farebná schéma"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Makrá v štýle C (všeobevné)"

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Použiť ANSI reťazce"

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "Ako je"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Štýl Assembleru:"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Správy"

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Kontroly:"

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Preklad"

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr ""

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operátory v štýle C (*=, +=, /= and -=)"

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr ""

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Vytvoriť Makefile"

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr ""

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr ""

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Generovať ladiace informácie pre DBX (pomalší preklad)"

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Ladenie:"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Ďalšie cesty debugera (žiadne):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Tvorba kódu"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""

#: lazarusidestrconsts.dlgcodegeneration
#, fuzzy
#| msgid "Code"
msgid "Code generation"
msgstr "Kód"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Rýchlejší kód"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Generovať ladiace informácie pre GDB (Pomalší preklad)"

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Generovať:"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Použiť jednotku Heaptrc"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Súbory include (-Fi)"

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Zdedené"

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Knižnice (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linkovanie"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Otvoriť/Uložiť"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr ""

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Parametre príkazového riadka"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parametre príkazového riadka (bez mena aplikácie)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr ""

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr ""

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr ""

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr ""

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Voľby prekladača"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Dokončovanie vlastností"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Konfiguračné súbory"

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Normálny kód"

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Voľby:"

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Ostatné"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Pretečenie"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analýza"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Rozsah"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Zobraziť chyby"

#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Zobraziť voľby"

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Menší kód"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Smart linkvteľné"

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Ostatné zdrojové kódy (súbory .pp/.pas, použité len IDE, nie prekladačom)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Zásobník"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Odstrániť symboly zo spustiteľného súboru"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Štýl jednotky:"

#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr ""

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Generovať kód pre valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE v štýle C++"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kurzor za EOL"

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Kurzor preskakuje výber"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Používateľská prípona (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor ciest"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Typ a cesta debugera"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Predvolený font editora"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Predvolená hodnota"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Rozšírenia Delphi 2"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Zmazať šablónu"

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Kompatibilné s Deplhi"

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Plocha"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Súbory plochy"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr ""

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Smer"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Adresár neexistuje"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Vypnúť anti-aliasing"

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr ""

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Down"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Pridať..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Späť"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tučné"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Podadresár"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Šablóny kódu"

#: lazarusidestrconsts.dlgedcolor
#, fuzzy
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Farba"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for pascal blocks"
msgstr ""

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Používateľom definovaná prípona"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Oneskorenie"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Delete"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Zobraziť"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Upraviť ..."

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Súbory editora"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Dokončovanie identifikátora"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Otočiť"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr ""

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Šikmé"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Font editora"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Výška fontu editora"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Voľby editora"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Žiadne chyby mapovania klávesov"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Off"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "On"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Podčiarknuté"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "&Celý rozsah"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Spýtať sa"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Poznámka: Projektové súbory sú všetky súbory v adresáre projektu"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Záloha"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Farby"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Súbory"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Mriežka"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Jazyk"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Pomocné čiary"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Rôzne"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Nič"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Ostatné súbory"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Po preklade zamerať správy"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Dodatočná medzera medzi znakmi"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Dodatočná medzera medzi riadkami"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Použiť externý súbor ladiacich symbolov gdb"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Prípony súborov"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Nájsť text na kurzore"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Súbor"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedúra"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Farba popredia"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Pravidlá vkladania procedúr"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Zachovať poradie procedúr"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Cesta prekladača (napr. %s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Adresár zdrojových kódov FPC"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor formulára"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "&Od kurzora"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Voľby"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr ""

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Získať pozíciu"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Globálne"

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "GPC (GNU Pascal Compiler) kompatibilné"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Generovať kód pre gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Farba zachytávača"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Farba mriežky"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Veľkosť mriežky X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Vodorovná veľkosť kroku mriežky"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Veľkosť mriežky Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Zvislá veľkosť kroku mriežky"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr ""

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Prostredie"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Pomoc"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Skupinové späť"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Zobraziť pomocné čiary"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Farba guttera"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Šírka guttera"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Polovičný posun stránky"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Veľkosť haldy"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Výška:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Pri spustení skryť okno IDE"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr ""

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Zvýrazniť"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Font zvýraznenia"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Zobraziť rady pre nepoužitý parameter \"Sender\""

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Zobraziť rady pre nepoužité jednotky v základnom zdrojovom súbore"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home posúva na najbližší začiatok"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Hosťovská aplikácia"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Dokončovanie identifikátorov"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Pravidlá identifikátora"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignorovať"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Vrátane systémových premenných"

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Odsadiť kód na"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr ""

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Pred metódy"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Meno konštruktora musí byť 'init' (deštruktor musí byť 'done')"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Vložiť medzeru za"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Vložiť medzeru pred"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval v sekundách"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Skákanie (tj. Skákanie na metódy)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Ponechať X pozíciu kurzora"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Mapovanie klávesov"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Chyba mapovania klávesov"

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Schéma mapovania klávesnice"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Pravidlá kľúčových slov"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Povoliť LABEL a GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Jazyk"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Posledný (tj. na konci kódu)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Adresár Lazarus (predvolený pre všetky projekty)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Vľavo:"

#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "farba ľavej a hornej"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Úroveň 1 (rýchle a priateľské debugeru)"

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Úroveň 3 (Úroveň 2 + pomalé optimalizácie)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Úroveň 0 (bez zvláštnych optimalizácií)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Rozdeľovanie riadkov"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Spôsob linkovania:"

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Smart linkovanie"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Zobraziť čísla riadkov v behovom výpise chýb"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Načítať nastavenia plochy zo súboru"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hlavné menu"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Zobraziť formuláre projektu"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Zobraziť rámce projektu"

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Zobraziť jednotky projektu"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Cesta k make"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Okraj a gutter"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Farba markera"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr ""

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum počítadla"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximálna dĺžka riadka:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum posledných súborov"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum posledných projektov"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Pravidlá vkladania metód"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Zmiešané metódy a vlastnosti"

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "šípka vľavo"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "šípka vpravo"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Povolené"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Pridať"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Delete"

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Down"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "šípka vľavo"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnok
#, fuzzy
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "šípka vpravo"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Zmeniť"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Up"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Akcia"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Akcia"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Poradie"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Výber"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr ""

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorita"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Správy"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Viacnásobný výber"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr ""

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Pomenovanie"

#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Bez automatického premenovania"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "Dole"

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "šípka vľavo"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "šípka vpravo"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "Hore"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Nerozdeľovať riadok za:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Nerozdeľovať riadok pred:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inšpektor objektov"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Výška položky"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Zaujímavé"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Voľby"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimalizácie:"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Ostatné súbory jednotiek (-Fu) (oddelené bodkočiarkou):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr ""

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr ""

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Rady pre paletu komponentov"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Predvolená prípona Pascalu"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr ""

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Poslať voľby linkovaču (oddeľovač je medzera)"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Predvolené"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Žiadne"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr ""

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Trvylý kurzor"

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Skupina balíčkov"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikácia"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Zmazať ikonu"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Vytvoriť zväzok aplikácií"

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr ""

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formuláre"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ikona:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(veľkosť: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(žiadne)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Načítať ikonu"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Zaujímavé"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Nastavenia výstupu"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Uložiť ikonu"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Relácia"

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Meno cieľového súboru:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titulok:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Použiť zväzok aplikácií pre spustenie a ladenie (lem darwin)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Použiť súbor manifestu, pre zapnutie tém (len Windows)"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Voľby projektu"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr ""

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Súbory projektu"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "&Spýtať sa pri nahradení"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Dokončovanie vlastností"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Meno vlastnosti"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr ""

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Pri spustení otvoriť posledný projekt"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Zobraziť border spacing"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Zobraziť dialóg prekladača"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Zobraziť mriežku"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Prichytiť k mriežke"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Odkazy"

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Regulárne výrazy"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "N&ahradiť všetko"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "Na&hradiť s"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Hlásenie"

#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "farba pravej a dolnej"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Kliknutie pravým vyberá"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Pravý okraj"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Pracovný adresár"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""

#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Vytváranie"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Výber"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Zobraziť (nie pre Win32, napr. 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Prostredie"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokálne"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systémové premenné"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Použiť displej"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Používateľské prepisuje"

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Premenná"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Parametre spustenia"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Uložiť nastavenie plochy do súboru"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Uložiť informácie editora pre zatvorené súbory"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Uložiť informácie editora len pre súbory projektu"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Rozsah"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Posunúť o jedno"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr ""

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Zobraziť rady posunu"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Rolovať za koniec súboru"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Rolovať za koniec riadka"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Hľadanie prerušené používateľom."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Hľadanie ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Cesty"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "&Vybratý text"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Nastaviť všetky prvky na predvolené"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Nastaviť prvok na predvolené"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Premenná nastavenia vlastnosti"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Zobraziť popisky komponentov"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Zobraziť preložené procedúry"

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Zobraziť voľby prekladača"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Zobraziť čísla riadkov"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Zobraziť podmienky"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Zobraziť ladiace informácie"

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Zobraziť definované makrá"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Zobraziť rady editora"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Zobraziť informácie o spustiteľnom súbore (len Win32)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Zobraziť všeobecné informácie"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Zobraziť panel pokynov"

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Zobraziť rady"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Zobraziť čísla riadkov"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Zobraziť poznámky"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Nezobrazovať nič (len chyby)"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Zobraziť pri chyb všetky procedúry"

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Zobraziť rady posunu"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Zobraziť súhrn"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Zobraziť spracovávané súbory"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Zobraziť použité jednotky"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Zobraziť upozornenia"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr ""

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr ""

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbol za (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Počítadlo (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbol pred (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Prichytiť k pomocným čiaram"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Medzera"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Rady pre základné tlačítka (Otvoriť, Uložiť, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor kódu"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Originál"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "V objektoch kľúčové slovo Static"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Zastaviť po počte chýb:"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Podvlastnosti"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Voľby syntaxe"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulátor odsadzuje blok"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátory na medzery"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Šírka tabulátora"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Cieľová rodina CPU"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Cieľový OS"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Cieľová platforma:"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Cieľový procesor"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Adresár pre vybudovanie testovacích projektov"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Hľadaný text"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Adresár \""

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "s"

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Rady vo Vyhodnocovaní výrazov"

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Rady v symboloch Nástrojov"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Hore:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Meno súboru šablóny"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Odstrániť zvyšné medzery"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Nespoľahlivé optimalizácie"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Späť po uložení"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr ""

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limit vrátenia"

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "Otvoriť"

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Závislosti jednotky"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Obnoviť"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Výstupný adresár jednotky (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Up"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Skladanie kódu"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr ""

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr ""

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Použiť štandardný konfiguračný súbor prekladača (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Použiť spúšťaciu aplikáciu"

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr ""

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr ""

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Použiť zvýrazňovanie syntaxe"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Výrečnosť počas prekladu"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Viditeľný gutter"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Viditeľný pravý okraj"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "Len &celé slová"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Šírka:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplikácia Win32 GUI"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Okno"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Pozície okna"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Slová"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Ukážka"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Zapísať logo FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Viacnásobný výber komponentov musí byť na jednom formulári."

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Zarovnať"

#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Zmazať výber"

#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Preklopiť vodorovne"

#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Preklopiť zvislo"

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Poradie"

#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Späť o jedna"

#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Dopredu o jedno"

#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Posunúť na koniec"

#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Posunúť na začiatok"

#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Uložiť formulár ako XML"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Mierka"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Vybrať všetky"

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Veľkosť"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Voľba: Prichytiť k mriežke"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Voľba: Prichytiť k pomocným čiaram"

#: lazarusidestrconsts.fdmtaborder
#, fuzzy
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Poradie pre tabulátor ..."

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Pridať súbor"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Pridať súbory"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Pridať súbory do balíčka"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Pridať súbory LFM a LRS, ak existujú"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Pridať do balíčka"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Pridať jednotku"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nejednoznačný typ predka"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nejednoznačné meno triedy"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nejednoznačné meno jednotky"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Typ predka"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Porušené závislosti"

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Meno triedy už existuje"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Vytvoriť nový súbor"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Závislosť"

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sExistujúci súbor: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Súbor už existuje"

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Súbor %s%s%s už v projekte existuje."

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Súbor už je v balíčku"

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Súbor je používaný"

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Meno súboru:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Meno súboru"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Súbor nie je jednotka"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Neplatný typ predka"

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Neplatný kruh"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Neplatné meno triedy"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Neplatný súbor"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Neplatné meno súboru"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s nie je platné meno jednotky."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Meno novej triedy:"

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Nový komponent"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nový súbor"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Nenájdený balíček pre závislosť %s%s%s.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Meno balíčka veľmi dlhé"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Stránky palety:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Jednotka pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Dialóg uloženia súboru"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Skrátené alebo úplné meno súboru"

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Prepnúť cesty"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Typ predka %s%s%s má rovnaké meno ako %sjednotka  %s%s%s."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Typ predka %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Meno triedy %s%s%s a typ predka %s%s%s sú rovnaké."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Meno triedy %s%s%s už existuje v %sBalíčku %s%sSúbor: %s%s%s"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Meno triedy %s%s%s má rovnaké meno triedy ako %sjednotka %s%s%s."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Meno triedy %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Súbor %s%s%s už je v balíčku."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Súbor %s%s%s je časťou aktuálneho projektu.%sNie je dobrý nápad zdieľať súbory medzi projektmi a balíčkami."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Meno súboru %s%s%s je neplatné, pretože balíček zatiaľ nemá predvolený adresár.%sProsím zadajte meno súboru s úplnou cestou."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximálna verzia %s%s%s je neplatná.%sProsím použite formát major.minor.release.build%sNapríklad: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximálna verzia je menšia ako Minimálna verzia."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimálna verzia %s%s%s je neplatná.%sProsím použite formát major.minor.release.build%sNapríklad: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Balíček už má závislosť na balíčku %s%s%s."

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Meno balíčka %s%s%s je neplatné.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Meno strany %s%s%s je príliš dlhé (max 100 znakov)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Meno jednotky %s%s%s už existuje v balíčku:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Meno jednotky %s%s%s už v tomto balíčku existuje."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Meno jednotky %s%s%s%sa meno súboru %s%s%s sú rôzne."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Meno jednotky %s%s%s nezodpovedá menu súboru."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Meno jednotky %s%s%s je rovnaké ako meno registrovaného komponentu.%sTakéto použitie môže spôsobiť nezvyklé chybové správy."

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Meno súboru jednotky:"

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Meno súboru jednotky:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Meno jednotky:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Meno jednotky už v existuje"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Prehľadať jednotku a zistiť meno jednotky a procedúru Register"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Zahodiť zmeny?"

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Nastala chyba pri vytváraní zväzku aplikácií:"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Zrušiť všetko"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Zrušiť všetky načítania"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Zrušiť načítanie projektu"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Zrušiť celé načítanie"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentácia:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "O Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licencia: GPL/LGPL%sLazarus je IDE pre tvorbu (grafických a konzolových) aplikácií pomocou Free Pascal. Free Pascal je (L)GPL Pascal a Object Pascal prekladač, ktorý beží vo Windows, Linux, Mac OS X, FreeBSD a iných.%sLazarus je chýbajúca časť skladačky, ktorá umožní vyvýjať programy pre všetky vyššie spomínané platformy v prostredí podobnom Delphi. IDE je RAD nástroj, ktorý zahŕňa návrhára formulárov.%sKeďže Lazarus narastá, potrebujeme viac vývojárov."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Nemôžem nájsť zoznam spolupracovníkov."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficiálne:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s nemôže uchovávať TControls.%sMôžete do nej vložiť len nevizuálne komponenty."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Poďakovanie"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktivuje syntax regulárnych výrazov pre text a nahradzovanie (presne ako perl)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktívny filter"

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "Pridať adresár"

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Pridať súbory adresára"

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Ďalšie voľby prekladača, zdedené z balíčkov"

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Pridať novú množinu"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Pridať %s do projektu?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Pridať do cesty hľadania jednotiek?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr ""

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Pridať súbor do balíčka"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Cieľový balíček"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Typ súboru"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Má procedúru Register"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Neplatný balíček"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Neplatný ID balíčka: %s%s%s"

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuálna jednotka (zdrojový kód nie je v balíčku)"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Balíček je len na čítanie"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Balíček %s%s%s nenájdený."

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Zobraziť všetko"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Súbor %s%s%s%sis už je v balíčku %s."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Balíček %s je len na čítanie."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Meno jednotky:"

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Súbor %s%s%s už existuje.%sNahradiť ho?"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Zarovnanie"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Všetky bloky vyzerajú OK."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Všetky súbory"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Povoliť Function Calls"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Dovoliť hľadanie na viacerých riadkoch"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Všetky úpravy v %s%s%s%sbudú stratené a súbor bude znova otvorený."

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternatívny kláves"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternatívny kláves (ale postupnosť dvoch)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr ""

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Nájdený nejednoznačný súbor"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Nájdený nejednoznačný súbor: %s%s%s%sTento súbor môže byť poškodený %s%s%s%s%sZmazať nejednoznačný súbor?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Nájdený nejednoznačný súbor"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Nájdená nejednoznačná jednotka"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Nájdená nejednoznačná jednotka"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor ukotvenia - nevybratý prvok"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ukotvenia vybratých prvkov"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Ukotviť k spodne strane súrodenca, zachovať medzeru okraja"

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Ukotviť·k·ľavej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Ukotviť·k·pravej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Ukotviť·k·hornej·strane·súrodenca,·zachovať·medzeru·okraja"

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Pri poslednom štarte nastala chyba pri otváraní %s!%s%sOtvoriť projekt znova?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr ""

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#, fuzzy
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Aplkácia%sGrafický lcl/freepascal program. Súbor programu je automaticky spravovaný Lazarom."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Meno triedy &Aplikácie"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "použiť príznaky budovania (-B) aj pre závislosti"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Okraj okolo prvku. Ostatné štyri okraje sú pridané k tejto hodnote."

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Súbor s jednoduchým programom Pascalu.%sMôže byť použitý na rýchle a nečisté testovanie.%sLepšie je vytvoriť nový projekt."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Spýtať sa pred nahradením nájdeného textu"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr ""

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr ""

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "koniec riadka"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "medzera"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "koniec slova"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""

#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Automatické vlastnosti"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Automaticky zobratiť Inšpektor objektov"

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Dostupné balíčky"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Záložný súbor zlyhal"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Zmena mena alebo verzie balíčka poruší závislosti. Majú byť zmenené aj tieto závislosti?%sZvoľte Áno pre zmenu všetkých zobrazených závislostí.%sZvoľte Ignorovať pre zrušenie závislostí a pokračovanie."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "začína"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Pred spustením vždy vybudovať"

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Vybudovať"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Príkaz Vybudovať"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Na vybudovanie projektu spusťte príkaz Vybudovať súbor"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Na spustenie projektu spusťte príkaz Spustiť súbor"

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Spustiť"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Príkaz spustiť"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Keď je tento súbor aktívny v editore ..."

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Pracovný adresár (prázdne pre cestu súboru)"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Pracovný adresár (prázdne pre cestu súboru)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Zmenené hodnoty tučne"

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "Medzera okraja"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Dole"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Spodný okraj. Táto hodnota je pridaná k základnému okraju a použitá pre medzeru pod prvkom."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Spodné ukotvenie"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Spodné okraje"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Toto je súrodenec prvku, ku ktorého spodnej strane je ukotvený. Ponechajte prázdne pre rodiča."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Rovnaká spodná medzera"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Zalomiť"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Nájsť prekladač (%s)"

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Zalomiť"

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Pokračovať"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "vybudovať všetky súbory projektu/balíčka/IDE"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "vybudovať IDE aj s balíčkami"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr ""

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Vybudovať nový projekt"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Číslo vybudovania"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Volanie %s na vytvorenie Makefile z %s zlyhalo."

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Zrušiť načítanie tohoto komponentu"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Zrušiť načítanie jednotky"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Zrušiť premenovanie"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Namôžete kopírovať najvyšší komponent"

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Nemožno vytvoriť súbor %s%s%s"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Nemožno nájsť spúšťač Lazarus: %s%s"

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Zmeniť možno len triedu TComponents"

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Zmeniť triedu %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "žiadna trieda"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Nejednoznačný prekladač"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Prosím skontrolujte testovací adresár v %sProstredie -> Voľby prostredia -> Súbory -> Adresár pre budovanie testovacích projektov"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Prekladač \"%s\" nie je spustiteľný súbor.%sDetaily: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "obsahuje "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Kopírovať výstup do  do schránky"

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Dátumy .ppu·súborov FPC sú rozdielne o viac ako hodinu.%sTo môže znamenať, že sú z rôznych inštalácií.%sSúbor1: %s%sSúbor2: %s"

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "súbor s anglickými správami pre fpc chýba: components/codetools/fpc.errore.msg"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "CHYBA:"

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Cesta k jednotkám FPC so zdrojovým kódom"

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "symboly nového riadka"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "RADA:"

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Neplatný prekladač"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Neplatná cesta hľadania"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Neplatný testovací adresár"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Chýbajúca jednotka"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "Preložená jednotka FPC nenájdená: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "nájdené viaceré konfigurácie prekladača:"

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg nenájdený"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "nie je ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu existuje dvakrát: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Preložená jednotka FPC %s.ppu nebola nájdená.%sToto zvyčajne znamená, že Váš fpc.cfg obsahuje chybu alebo je Vaša inštalácia FPC poškodená."

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Existujúci súbor .ppu je starší ako prekladač samotný:%s%s"

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "nájdená relatívna cesta jednotky v fpc cfg: %s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Preskočiť"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "špeciálne znaky"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Všetky testy úspešné."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "textového vytvoriť testovací súbor"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "textového vytvoriť testovací pascalovský súbor \"%s\"."

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Nemožno získať dátum súboru %s."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "nezvyčajné znaky"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Upozorňovanie"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "UPOZORNENIE:"

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "zlý oddeľovač cesty"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Kategórie"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konštanty"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filter)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Nasledovať kurzor"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr ""

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Zobraziť kategórie"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Zobraziť uzly zdrojového kódu"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Centrovať prvky vodorovne, relatívne k daným súrodencom"

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Centrovať·prvky·zvislo,·relatívne·k·daným·súrodencom"

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr ""

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centrovať v okne"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Stredy"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Preferovaný ukážkový režim"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Kategória"

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr "Zdrojový kód"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nikdy, len manuálne"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Použiteľné len v režime kategórie"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Pri nečinnosti"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Obnoviť automaticky"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Ostatné"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aktualizovať"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Pri prepínaní súboru v editore"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedúry"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Vlastnosti"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr ""

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Štýl"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Typy"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Premenné"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Zmeniť triedu"

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Zmeniť kódovanie"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Zmeniť súbor"

#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "Zmeniť rodiča ..."

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Znak"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa znakov"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Skontrolovať zmeny pri načítaní"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Skontrolovať voľby"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Zvoľte iné meno"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Zvoľte odkaz FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Zvoľte kláves..."

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr ""

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr ""

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Vyberte meno súboru prekladača (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Zvoľte meno súboru debugera"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Zvoliť jednotku Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Zvoľte adresár"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Vyberte adresár zdrojových kódov FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Vyberte adresár Lazarus"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Vyberte cestu k make"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr ""

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Zvoľte položku pre vytvorenie nového súboru"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Zvoľte položku pre vytvorenie nového balíčka"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Zvoľte položku pre vytvorenie nového projektu"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Zvoľte jednu z týchto položiek, z ktorej bude dedené"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Zvoľte zdrojový kód programu (*.pp, *.pas, *.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Zvoľte štruktúru pre uzavretie výberu"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Konflikt triedy so súborom .lfm:%sJednotka %s%spoužíva jednotku %s%s, ktorá obsahuje triedu %s,%s, ale súbor .lfm už obsahuje inú triedu.%sMôže byť len jeden návrh triedy na jednotku.%sPresuňte prosím %s do inej jednotky."

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Trieda %s%s%s nie je triedou registrovaného komponenta.%sNemožno vložiť."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Trieda nenájdená"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Nenájdená trieda %s%s%s metódy %s%s%s."

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Vyčistiť adresár"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Vyčistiť podadresáre"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Ponechať všetky textové súbory"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Ponechať všetky súbory vyhovujúce filtru"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Odstrániť súbory vyhovujúce filtru"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Jednoduchá syntax (napr. * namiesto .*)"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Vyčistiť zdrojové kódy Lazarus"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Vyčistiť cestu jednotky?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Vyčistiť adresár?"

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr ""

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Pre prehľadávanie súboru kliknite tu"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Zatvoriť"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr ""

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Špecifické voľby rozhrania LCL:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponenty"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Dedičnosť"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Zoznam"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Nejednoznačný dodatočný konfiguračný súbor prekladača"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Volať na:"

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Vybudovať"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Preložiť"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Spustiť"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKliknite na OK, ak ste si istí vykonaním."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Príkaz:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "predvolené (%s)"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Voľby generovania kódu"

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Pridať odkaz"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Pridať cestu"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Prezerať"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Potvrdiť nahradenie"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Vytvoriť položku pomoci"

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Zmazať odkaz"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Odstrániť cestu"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Popis"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Chyby"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Príklad"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Vložiť formátovaciu značku pre kód"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Vložiť formátovaciu značku pre kurzívu"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Vložiť formátovaciu značku poznámky"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Vložiť formátovaciu značku pre podčiarknuté"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Vložiť formátovaciu značku var"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Zdedené"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Vložiť odkaz ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Vložiť značku formátovania odseku"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "Editor·FPCDoc"

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(žiadne)"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenájdený zdedený popis)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NIČ>"

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "Cesta súborov FPDoc"

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "Nahradiť"

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "Uložiť"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Pozri aj"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Krátky popis"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Krátky"

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Zobraziť prázdne metódy"

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr ""

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Pridať"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Pridať šablónu kódu"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Token %s%s%s už existuje!"

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Automatické dokončovanie na ..."

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Zmeniť"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentár:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Upraviť šablónu kódu"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Akcia: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automaticky vytvorené uzly nemôžu byť upravované,%sani nemôžu mať neautomaticky vytvorené podriadené uzly"

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, auto generované"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automaticky generované uzly nemôžu byť upravované."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor definícií CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Ukážka definícií CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "cesta prekladača"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konvertovať uzol"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Vytvoriť definície pre adresár %s"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Vytvoriť definície pre prekladač FreePascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Vytvoriť definície pre Vytvoriť definície pre FreePascal "

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Vytvoriť definície pre adresár Lazarus"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Vytvoriť definície pre projekt %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Vytvoriť FPC makrá a cesty pre adresár projektu fpc"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definovať"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definovať rekurzívne"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Zmazať uzol"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Popis:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s adresár"

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Upraviť"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Chyba čítania %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Chyba čítania informačného súboru projektu %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Chyba počas zápisu %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Chyb počas zápisu projektu do súboru %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Skončiť"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Skončiť bez uloženia"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "SVN Adresár zdrojových kódov FPC"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Adresár"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Vložiť šablónu projektu Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Vložiť šablónu projektu Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Vložiť šablónu prekladača Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Vložiť šablónu adresára Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Vložiť šablónu projektu Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Vložiť šablónu prekladača FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Vložiť šablónu projektu FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Vložiť šablónu SVN zdroja FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Vložiť šablónu prekladača Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Vložiť šablónu adresára Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Vložiť šablónu projektu Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Vložiť šablónu adresára Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Vložiť podriadený uzol"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Vložiť uzol pod"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vložiť šablónu"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Neplatný rodič"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Neplatný rodičovský uzol"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Neplatný predchádzajúci uzol"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%sNapríklad: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "%s základný adresár,%sv ktorom má Borland nainštalované všetky %s zdrojové kódy,%spoužité týmto %sprojektom.%sNapríklad: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Adresár Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Posunúť uzol nižšie"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Posunúť uzol o úroveň nižšie"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Posunúť uzol o úroveň vyššie"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Posunúť uzol vyššie"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Meno:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nový uzol"

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Uzol a jeho položky sú platné len pre tento projekt"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Uzol je len na čítanie"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "nevybraté"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Rodičovský uzol nemôže obsahovať podriadené uzly"

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Predchádzajúci uzol nemôže obsahovať vnorené uzly."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Adresár projektu"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s adresár projektu"

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Chyba čítania"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Uložiť a skončiť"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Zvolený uzol:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Zdrojový adresár Free Pascal SVN. nevyžadované, ale zlepšuje hľadanie deklarácií a ladenie."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Adresár projektu Free Pascal."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Zdrojový adresár Free Pascal SVN."

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Základný adresár Lazarus."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Cesta k prekladaču Free Pascal.%s Napríklad %s/usr/bin/%s -n%s alebo %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Cesta prekladača Free Pascal pre tento projekt. Vyžadované len ak nastavíte FPC SVN zdroj nižšie. Použité pre makrá autocreate."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Adresár projektu %s, ktorý obsahuje súbory .dpr, dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Zrušiť definíciu"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Zrušiť všetky definície"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Zrušiť definíciu rekurzívne"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Hodnota ako text"

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Premenná:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Na"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Stĺpec"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Čiarka"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Kľúčové slovo"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nový riadok"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Žiadne"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Číslo"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "Ok"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Bod"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Bodkočiarka"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Medzerník"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Reťazcová konšt."

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Spustiť po"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Spustiť pred"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Zbaliť všetky triedy"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Zbaliť všetky balíčky"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Zbaliť všetky jednotky"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Príkaz po"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Príkaz za neplatným"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Príkaz po publikovaní modulu"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parametre príkazového riadka programu"

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Preložiť IDE (bez linkovania)"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Prekladač"

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Chyba prekladača"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Chyba: neplatný prekladač: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Meno súboru prekladača"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Rada: cestu prekladača môžete nastaviť v Prostredie->Voľby prostredia->Súbory->Cesta prekaldača"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Poznámka: Nenájdený konfiguračýs úbor CodeTools - použité predvolené"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Poznámka: načítanie starého súboru volieb CodeTools"

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Voľby prekladača pre Projekt: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (prekladám ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "Komponent"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr ""

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Meno komponentu %s%s%s je kľúčové slovo"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Názov komponentu %s%s%s nie je platný identifikátor"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Nájsť komponent"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Otvoriť balíček"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Otvoriť jednotku"

#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Test"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Podmienka"

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr ""

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Konfiguračný adresár Lazarus"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Konfigurovať budovanie %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Potvrdiť zmeny"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Chcete prebudovať Lazarus?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Potvrdiť nastavenia nového balíčka pre IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Akcia"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konzolová aplikácia"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Kód konštruktora"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "obsahuje"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Pokračovať"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Pokračovať bez načítania formulára"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Spolupracovníci"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Ovládací prvok musí mať rodiča"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr ""

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr ""

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Chyba konverzie"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Konvertovať"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Konvertovať kódovanie"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Konvertovať kódovanie projektov/balíčkov"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Konvertovať projekt alebo balíček"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlaz
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphi
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazwinonly
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Kopírovať všetko"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Chyba kopírovania"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Chyba kopírovania"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopírovanie celého formulára nie je implementované"

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Kopírovať vybrané správy do schránky"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Hľadať správy FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Hľadať správy Make"

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Zobraziť všetky správy"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Preskočiť volanie prekladača"

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Špecifické voľby cieľového OS"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (rôzne)"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Upozornenie: Dodatočný konfiguračný súbor prekladača má rovnaké meno ako jeden zo štandardných mien konfiguračných súborov prekladača FreePascal. Toto môže mať za následok spracovanie dodatočného konfiguračného súboru a preskočenie štandardného."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Otvoriť balíček %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Otvoriť jednotku  %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Najprv vytvorte projekt!"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Vytvoriť adresár?"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Vytvoriť uzol Pomoci"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Vytvoriť v"

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Vytvoriť nový projekt"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Zvoliť adresár"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Hodnoty adresárov CodeTools"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definovať šablóny"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<premenná nezvolená>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Otvoriť ukážku"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Nástroje"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Premenná: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Meno premennej"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Šablóny"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "prosím vyberte makro"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Vybrať makro kódu"

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr "Aktuálny"

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Stĺpec kurzora v aktuálnom editore"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Riadok kurzora v aktuálnom editore"

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr ""

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "vlastné voľby"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Vlastné voľby"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Vlastný program"

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#, fuzzy
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Vlastný program%sProgram FreePascal."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Dátum"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Delete"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Delete"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nie je zadaný debuger"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Nastaviť bod prerušenie hocikde"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Nie je definovaný debuger.%sNastavenie bodu prerušenia nemá význam, dokiaľ nenastavíte debuger v dialógu Voľby debugera v menu."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Chyba debugera"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Chyba debugera %sDebuger vstúpil do chybového stavu%sUložte svoju prácu!%sPoužite Stop, a dúfajte v najlepšie, we're pulling the plug."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Neplatný debuger"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (ladím ...)"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Ďalšia prehľadávaná cesta"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Bod prerušenia"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Pri spustení zmazať záznam"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Všeobecné voľby debugera"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Špecifické voľby debugera (závisia na type debugera)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Záznam udalostí"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Obslúžené"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Obslúžené debugerom"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Obslúžené programom"

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorovať tieto výnimky"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Výnimky jazyka"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Obmedziť počet riadkov na"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Meno"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Výnimky OS"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Výstup"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proces"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Pokračovať"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Pokračovať obslúžené"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Pokračovať neobslúžené"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Zobraziť Správy pri zadstavení"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signály"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Vlákno"

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Okno"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Nemožno načítať súbor"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Nemožno načítať súbor %s%s%s."

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr "Desiatkovo"

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr ""

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr ""

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Z&mazať všetky "

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Zmazať všetky body prerušenia?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Zmazať všetky body prerušenia v súbore %s%s%s?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Zmazať všetky v rovnakom zdroji"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Zmazať všetky vybraté body prerušenia"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Zmazať všetky tieto súbory?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Zmazať nejednoznačný súbor?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Zmazať bod prerušenia na %s\"%s\" riadku %d?"

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Zmazanie súboru zlyhalo"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr ""

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Zmazať starý súbor %s%s%s?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Zmazať staré súbory?"

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr ""

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Zmazať označené riadky"

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Mazanie súboru %s%s%s zlyhalo."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr ""

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Projekt Delphi"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Komponent s menom  %s%s%s už existuje."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Cieľový adresár"

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Cieľový adresár %s%s%s nie je platný.%sProsím zvoľte úplnú cestu."

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Kód deštruktora"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Necitlivé na veľkosť"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorovať prázdne riadky pri pridávaní a odstraňovaní"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorovať rozdiely koncov riadkov (e.g. #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorovať niekoľko znakov medzery"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorovať medzery (mimo znakov nového riadka)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorovať medzery na konci riadka"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorovať medzery na začiatku riadka"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Len výber"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Otvoriť rozdiel v editore"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Číslice:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktívy"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Zakázané"

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr "Zakázať skupinu"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Zahodiť zmeny"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Zmenené súbory:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kliknite na jednu z položiek pre zobrazenie rozdielov"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Chyba čítania súboru: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorovať zmeny disku"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Znova načítať z disku"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Niektoré súbory boli na disku zmenené:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Rozoznávať veľké a malé písmená, napr. C a c"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editor dokumentácie"

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s neexistuje: %s"

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Nezatvárať IDE"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Nezatvárať projekt"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "neprekladať závislosti"

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr ""

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Nezobrazovať úvodnú obrazovku"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Kresliť mriežku"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kopírovať vybraté komponenty do schránky"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Vystrihnúť vybraté komponenty do schránky"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Presunúť komponent o jeden vzad"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Presunúť komponent o jeden vpred"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Presunúť komponent dozadu"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Presunúť komponent dopredu"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Vložiť vybraté komponenty zo schránky"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Vybrať rodičovský komponent"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Duplikované meno: Komponent pomenovaný %s%s%s už existuje v zdedených komponentoch %s"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Upraviť kontextovú pomoc"

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Zvoľte schému"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Všetky balíčky"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuálny projekt"

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Adresár aktuálneho projektu"

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Dodatky k všeobecnej ceste k zdrojovým kódom"

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Cesta k include projektu"

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Cesta k zdrojovým kódom projektu"

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Cesta k jednotkám projektu"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Všetky projekty"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "nastaviť režim FPC na DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "nastaviť režim FPC na FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "nastaviť režim FPC na GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "nastaviť režim FPC na MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "nastaviť režim FPC na TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "zapnúť IOCHECKS"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "zapnúť OVERFLOWCHECKS"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "zapnúť RANGECHECKS"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "použiť jednotku HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "použiť jednotku LineInfo"

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Platný nástroj musí mať aspoň titulok a meno súboru"

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Upraviť Nástroj"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Vložiť"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Kláves"

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Makrá"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametre:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Meno súboru programu:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Vo výstupe hľadať správy FPC"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Vo výstupe hľadať správy make"

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titulok a meno súboru sú vyžadované"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Pracovný adresár:"

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Všetko"

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Prázdne metódy"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Nájdené prázdne metódy:"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Len published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Odstrániť metódy"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Prehľadávať tieto sekcie triedy:"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "Nastaviť vš&etky"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Povoliť všetko v rovnakom zdroji"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Povolené"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr "Povoliť skupinu"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Zapnúť makrá"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Uzavrieť"

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr "Uzavrieť výber"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Kódovanie súboru %s%s%s%sna disku je %s. Nové kódovanie je %s."

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Kódovanie súboru %s%s%s%sna disku je %s. Nové kódovanie je %s."

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Zadajte jazyk prekladu"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr ""

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Adresár nenájdený"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Adresár zdrojových kódov FCP \"%s\" nenájdený."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Neplatné meno prekladača"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Súbor prekladača \"%s\" nie je spustiteľný."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Neplatné meno debugera"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Súbor debugera \"%s\" nie je spustiteľný."

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#, fuzzy
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Adresár zdrojových kódov FPC \"%s\" vyzerá byť zlý. Bežne obsahuje adresáre ako rtl, packages, compiler, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Adresár Lazarus \"%s\" nevyzerá správne. Štandardne obsahuje adresáre ako lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Neplatné meno súboru make"

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Súbor make \"%s\" nie je spustiteľný."

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Adresár Lazarus \"%s\" nenájdený."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testovací adresár \"%s\" nenájdený."

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "Poznámka: teraz sú podporované len absolútne cesty"

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Šírka tabulátora"

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Neplatná voľba na pozícii %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Voľba na pozícii %d nedovoľuje argument: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Voľba na pozícii %d vyžaduje argument: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Chyba:"

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Chyba vytvárania súboru"

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Chyba vytvárania lrs"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Chyba mazania súboru"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Chyba v %s"

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Chyba inicializácie programu%s%s%s%s%sChyba: %s"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Chyba načítania súboru"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Chyba načítania %s z%s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Chyba presúvania komponentu"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Chyba presúvania komponentu %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Chyba otvorenia komponentu"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Chyba analýzy toku komponentov lfm."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Chyba čítania zoznamu balíčkov zo súboru %s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Chyba čítania XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Chyba čítania XML súboru %s%s%s%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Chyba premenovania súboru"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Chyby"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Chyba pri ukladaní %s do%s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Chyba zápisu zoznamu balíčkov do súboru%s%s%s%s"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Upraviť vlastné skenery (%s)"

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr ""

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Každé n-té číslo riadka:"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Príklady"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Príklady:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr ""

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Vylučovací filter"

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "Filter vylúčenia"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Vykonať príkaz po"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Vykonať príkaz pred"

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Vykonávanie prerušené"

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Vykonávanie prerušené%s  Adresa: $%s%s  Procedúra: %s%s Súbor: %s%s(Niekedy sa tu môže objaviť okno assemblera:)%s"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Vykonávanie zastavené"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programy"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Rozbaliť všetky triedy"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Rozbaliť všetky balíčky"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Rozbaliť všetky jednotky"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Úplné meno súboru aktuálneho súboru editora"

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Exportovať ..."

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportovať zoznam"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Výraz:"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Rozšíriť cestu jednotky?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Oddeliť"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Oddeliť procedúru"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Externé nástroje"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Zlyhalo spustenie nástroja"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Disahnuté maximum nástrojov"

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Down"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Up"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Odstrániť"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Už tam je maximum z %s nástrojov."

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" dokončené"

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Nemožno spustiť nástroj %s%s%s:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Redukovať kreslenie návrhára"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Kresliť položky návrhára len pri nečinnosti (redukuje zaťaženie per slabšie počítače)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Súbor %s%s%s%snevyzerá ako textový súbor.%sOtvoriť ho i tak?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Súbor %s%s%s%snevyzerá ako textový súbor.%sOtvoriť ho i tak?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Prípona súboru programu"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Súborový filter"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Súbor nie je zapisovateľný"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Súbor je symbolický odkaz"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Súbor %s%s%s je virtuálny."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Chyba linkovania súboru"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Meno súboru/adresa"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Súbor nenájdený"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Súbor %s%s%s nenájdený.%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Súbor %s%s%s nenájdený.%sChcete ho vytvoriť?%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Súbor nie je malými znakmi"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Súbor nie je textový"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "Nastavenia súboru ..."

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Súbory v kódovaní ASCII alebo UTF-8"

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Súbory nie sú v kódovaní ASCII ani UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "súbor, do ktorého je zapísaný výstup ladenia. Ak nie je zadaný, ladiaci výstup je vypísaný do konzoly."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filter"

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(filter)"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Množiny filtrov"

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Citlivé na veľkosť"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Voľby adresára"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Maska súboru (*;*.*;*.bak?)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Vrátane podadresárov"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Viacriadkový vzor"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Upraviť šablóny kódu"

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Regulárne výrazy"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "prehľadávať všetky súbory v &projekte"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "prehľadávať a&dresáre"

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Hľadaný text:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Kde"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "Len &celé slová"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Nájsť kombináciu klávesov"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Opraviť súbor LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Plávajúca čiarka"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Vynútiť premenovanie"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Chyba formátu"

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Chyba načítania formulára"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake zlyhal"

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Komponenty"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr ""

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Chyba adresára zdrojových kódov FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Verzia FPC:"

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Verzia FPC (napr. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPCDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Nájsť komponent palety"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Spätné hľadanie"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Nenájdený prekladač Free Pascal"

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#, fuzzy
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Program FreePascal používajúci TCustomApplication pre ľahšie zisťovanie volieb príkazového riadka, obsluhu výnimiek, atď. Súbor programu je automaticky spravovaný Lazarom."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Adresár zdrojov FreePascal"

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Súbor zdrojového kódu FreePascalu"

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Nenájdené zdrojové kódy FreePascalu"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Hľa&dať dopredu"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Ďalšie súbory pre hľadanie (napr. /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Nájsť alebo premenovať identifikátor"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Nájsť odkazy"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identifikátor: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "vo všetkých balíčkoch a projektoch"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "v aktuálnej jednotke"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "v hlavnom projekte"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "v projekte/balíčku vlastniacom aktuálnu jednotku"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Neplatný identifikátor"

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Premenovať"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Premenovať všetky referencie"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Premenovať na"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Hľadať aj v komentároch"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Kde hľadať"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "Funkcia"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr ""

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Choď na zvolený riadok zdrojového kódu"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <rok> <meno autora> <kontakt>%sTento zdrojový kód je slobodný softvér; môžete ho rozširovať a/alebo upravovať podľa podmienok GNU Všeobecnej verejnej licencie, tak ako je zverejnené Nadáciou Free Software; verzie 2 licencie alebo (podľa svojho rozhodnutia) akejkoľvek neskoršej verzie. %sTento zdrojový kód je šírený v nádeji, že bude užitočný, ale BEZ AKEJKO2VEK ZÁRUKY; dokonca aj bez zahrnutej záruky PREDAJNOSTI alebo VHDODNOSTI NA PRÍSLUŠNÝ ÚČEL.  Ďalšie detaily si pozrite v GNU Všeobecnej verejnej licencii. %sKópia GNU Všeobecnej verejnej licencie je dostupná cez World Wide Web na <http://www.gnu.org/copyleft/gpl.html>. Môžete ju získaj aj napísaním do Nadácie Free Software, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Skupina"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Rozšíriť na najväčšie"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Má pomoc"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Hlavičkový komentár pre triedu"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Položky pomoci"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Výber pomoci"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Šestnástkovo"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Pomoc pre správu FreePascal Compiler"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Rada: Skontrolujte, či dva balíčky neobsahujú jednotku s rovnakým menom."

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr ""

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Otvoriť"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "Prerušiť"

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Spustiť"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "Uložiť"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Uložiť všetko"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Krok dnu"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Krok cez"

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Zastaviť"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Rada: Funkcia \"Vytvoriť ResourceString\" očakáva reťazcovú konštantu.%sProsím vyberte výraz a skúste znova."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Rada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu.%sProsím vyberte len reťazcový výraz a skúste znova."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Prepnúť formulár/jednotka"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Zobraziť formuláre"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Databázy"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Voľby pomoci"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Vlastnosti:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Prehliadača"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Cesta k HTML dokumentácii FPC"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Vodorovne"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "Rozhranie IDE"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identifikátor začína s ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identifikátor obsahuje ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Voľby IDE:"

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr ""

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Chyba prístupu k XML"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Chyba prístupu k súboru xml %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Chyba načítania XML"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Chyba načítania súboru XML %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Exportovaný súbor existuje"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Exportovaný súbor %s%s%s existuje.%sotvoriť súbor a nahradiť len voľby prekladača?%s(Ostatné nastavenia ostanú zachované.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Načítať zo súboru"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Otvoriť alebo načítať voľby prekladača"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Otvoriť nedávne"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Nedávne súbory"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Uložiť do súboru"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Uložiť k nedávnym"

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorovať všetko"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorovať a pokračovať"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorovať binárky"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr ""

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Ignorovať chýbajúci súbor"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorovať použitie TForm ako predka"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importný zoznam"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Zahŕňací filter"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "cesta include"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Cesty Include"

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr ""

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr ""

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Index"

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr "Zrušené..."

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Preloži projekt"

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "Prekladanie ..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr "Chyba ..."

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Chyby:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Rady:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Riadky:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Zrušiť"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Poznámky:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "Úspešné ..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Upozornenia:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informácie o %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr ""

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Zdedená položka"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Pred vytvorením čistej kópie projektu/balíčka, budú zmazané všetky súbory všetky súbory v cieľovom adresári a všetok ich obsah stratený.%s%sZmazať všetky súbory v %s%s%s?"

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Vložiť makro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Vlastnosti"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Inštalácia zlyhala"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Nainštalovať výber"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr ""

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr ""

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "Neplatný kruh"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Neplatný príkaz"

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Neplatné mazanie"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Neplatný cieľový adresár"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Neplatný výraz:%s%s%s%s"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Neplatný výraz.%sRada: Funkcia \"Vytvoriť Resourcestring\" očakáva reťazcovú konštantu v jednom súbore. Prosím vyberte výraz a skúste znova."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Neplatný filter"

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Neplatný adresár zdrojových kódov FreePascal"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Neplatný viacnásobný výber"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Neplatné (vypnuté)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Neplatné (zapnuté)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Neplatný identifikátor Pascalu"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Meno \"%s\" nie je platný identifikátor Pascalu."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Neplatné meno procedúry"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Neplatné meno súboru projektu"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Neplatný adresár publikovania"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Neplatný výber"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr ""

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s už je časťou projektu."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s nie je platné meno projektu.%sProsím vyberte iné  (napr. project1.lpi)"

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s je %s.%sTakáto kruhová závislosť nie je dovolená."

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr ""

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "JIT Formulár"

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr ""

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Zachovať meno"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Ponechať a pokračovať"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Vlastné príkazy"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Príkazy návrhára"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Príkazy Inšpektora objektov"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Kláves (alebo postupnosť dvoch)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Zrušiť budovanie"

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Pridať aktívnu jednotku do projektu"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Pridať pozorovanie"

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Vybudovať všetky súbory projektu/programu"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Vybudovať projekt/program"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasický"

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Zatvoriť všetko"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Zatvoriť projekt"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Voľby prekladača"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Konfigurovať %sVybudovanie súboru%s"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Konfigurovať voliteľné komponenty"

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Konfigurovať pomoc"

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#, fuzzy
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Konfigurovať inštalované balíčky"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextovo závislá pomoc"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Konvertovať balíček Delhi na Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Konvertovať projekt Delphi na Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Konvertovať jednotku Delphi na Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Konvertovať súbor DFM na LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Kopírovať vybraté komponenty do schránky"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Vystrihnúť zvolené komponenty do schránky"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Zmazať posledný znak"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Rozdiely súborov editora"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Upraviť šablóny kódu"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Upraviť kontextovo závislú pomoc"

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Voľby editora"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Uzavrieť výber"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Vyskúšať/Upraviť"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Nastavenie externých nástrojov"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Nájsť narastajúco"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Choď na značku 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Choď na značku 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Choď na značku 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Choď na značku 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Choď na značku 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Choď na značku 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Choď na značku 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Choď na značku 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Choď na značku 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Choď na značku 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Choď na editor zdrojových kódov 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Choď na editor zdrojových kódov 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Choď na editor zdrojových kódov 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Choď na editor zdrojových kódov 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Choď na editor zdrojových kódov 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Choď na editor zdrojových kódov 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Choď na editor zdrojových kódov 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Choď na editor zdrojových kódov 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Choď na editor zdrojových kódov 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Choď na editor zdrojových kódov 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Vložiť dátum a čas"

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Vložiť $IFDEF"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Vložiť meno používateľa"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Skontrolovať"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Schéma rozloženia klávesnice"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (predvolené)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (štýl Apple )"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (štýl Lazarus)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nový balíček"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nový projekt"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nový projekt zo súboru"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nová jednotka"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Otvoriť súbor balíčka"

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "Graf balíčkov"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Vložiť komponenty zo schránky"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Prerušiť program"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publikovať projekt"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Odstrániť aktívnu jednotku z projektu"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Spustiť program"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Uložiť všetky"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Uložiť ako"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Uložiť projekt"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Uložiť projekt ako"

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Vybrať koniec riadka"

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Vybrať začiatok riadka"

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Vybrať spodok stránky"

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Vybrať vrchol stránky"

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Vybrať slovo naľavo"

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Vybrať slovo napravo"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Nastaviť voľnú záložku"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Nastaviť značku 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Nastaviť značku 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Nastaviť značku 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Nastaviť značku 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Nastaviť značku 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Nastaviť značku 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Nastaviť značku 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Nastaviť značku 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Nastaviť značku 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Nastaviť značku 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Zastaviť program"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Prepnúť medzi Jednotkou a formulárom"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Prepnúť zobrazenie Body prerušenia"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Prepnúť zobrazenie Zásobník volaní"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Prepnúť zobrazenie Prieskumník kódu"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Prepnúť zobrazenie Palety komponentov"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Prepnúť zobrazenie Výstup debugera"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Prepnúť zobrazenie Editor dokumentácie"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Prepnúť zobrazenie tlačítiek IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "prepnúť zobrazenie Lokálne premenné"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Prepnúť zobrazenie Správy"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Prepnúť zobrazenie Inšpektor obejktov"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Prepnúť zobrazenie Výsledky hľadania"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Prepnúť zobrazenie Editora zdrojových kódov"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Prepnúť zobrazenie Pozorovaní"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Zobraziť históriu skokov"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Zobraziť voľby projektu"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Zobraziť zdrojový kód projektu"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Neplatné spúšťanie aplikácie"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Spustenie cieľového príkazového riadka"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Nastavenia plochy Lazarus"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Adresár Lazarus"

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Adresár Lazarus nenájdený"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "Súbor Lazarus"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Formulár Lazarus"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Include súbor Lazarus"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Identifikátor jazyka Lazarus (napr. en, de, sk)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Meno jazyka Lazarus (napr. english, slovak)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [voľby] <meno-suboru-projektu>"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Balíček Lazarus"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Projekt Lazarus"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Informačný súbor projektu Lazarus"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Zdrojový kód Lazarus"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Jednotka Lazarus"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Akcia"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Zvoľte výstupný adresár pre spustiteľné súbory IDE"

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "Časť"

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Pridať"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Pokročilé voľby budovania"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Vybudovať"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Vybudovať CodeTools"

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Vybudovať komponenty (SynEdit, CodeTools)"

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "Vybudovať príklady"

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Vybudovať IDE"

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Vybudovať formulár JIT"

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Vybudovať SynEdit"

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Vyčistiť všetko"

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Vyčistiť + vybudovať"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr ""

#: lazarusidestrconsts.lislazbuildconfirmbuild
#, fuzzy
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "Potvrdiť pred prebudovaním Lazarus"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisovania súboru"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild nie je interaktívny, ruším."

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Nič"

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "Ok"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Voľby:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr "Vybudovať všetko"

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "Vybudovať IDE bez balíčkov"

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "Vybudovať IDE a balíčky"

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "Vybudovať LCL"

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Vyčistiť + Vybudovať všetko"

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Obnoviť"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Odstrániť"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Premenovať"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""

#: lazarusidestrconsts.lislazbuildrestartafterbuild
#, fuzzy
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "Po úspešnom vybudovaní reštartovať"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Uložiť nastavenia"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cieľový CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Cieľový adresár:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Cieľový OS:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Nemožno zapísať súbor \"%s\":%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr "S balíčkami"

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Chýba cesta k jednotkám LCL"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Typ LCL Widgetu"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Pridať odkaz k zdedeným"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Kopírovať zo zdedených"

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s nemá žiadnu platnú cestu LazDoc.%sNemožno vytvoriť súbor fpdoc pre %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Presunúť položky do zdedených"

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Neplatná cesta LazDoc"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Jednotku %s nevlastní žiadny balíček alebo projekt.%sProsím pridajte jednotku do balíčka alebo projektu.%sNemožno vytvoriť súbor fpdoc."

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Nechajte prázdne pre predvolený .po súbor"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "šípka vľavo"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Ľavý·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vľavo od prvku."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ľavé ukotvenie"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·ľavej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Ľavé strany"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Rovnaká ľavá vzdialenosť"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Úrovne"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM súbor"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM súbor poškodený"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<popis>%sCopyright (C) <rok> <meno autora> <kontakt>%sToto je slobodný program;môžete ho distribuovať a/alebo upravovať za podmienok GNU Library General Public License, tak ako ju zverejnila Free Software Foundation; buď verzie 2 Licencie alebo (podľa Vašej voľby) akejkoľvek novšej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#, fuzzy
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Knižnica%sKnižnica Free Pascal (.dll vo Windows, .so v Linuxe, .dylib v MacOS X). Súbor zdrojového kódu knižnice je automaticky spravovaný Lazarom."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "cesta knižnice"

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Dĺžka riadka"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Odkaz:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "voľby linkera"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Cieľ linkovania"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "načítanie %s zlyhalo."

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Meno"

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr ""

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Logo"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr ""

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr ""

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Zadajte dáta"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Zadajte parametre spustenia"

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr ""

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Základná jednotka obsahuje Application.CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Základná jednotka obsahuje Application.Title"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Základná jednotka má v sekcii uses všetky jednotky projektu"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Urobiť spustiteľné"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make nenájdený"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Vytvoriť ResourceString"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Pripojiť k výberu"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s už existuje.%sProsím zvoľte iné meno.%sPoužite Ignorovať pre jeho pridanie."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Voľby konverzie"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Vlastný identifikátor"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identifikátor"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Dĺžka identifikátora:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Predpona identifikátora:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Vložiť podľa abecedy"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Vložiť v závislosti na kontexte"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Neplatný výber ResourceString"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Prosím zvoľte sekciu resourcestring zo zoznamu."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "ResourceString už existuje"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Výber ResourceString:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Ukážka zdrojového kódu"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Reťazcová knštanta v zdrojovom kóde"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Reťazce s rovnakou hodnotou:"

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Max %d"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Výpis pamäte"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Zrušiť budovanie"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Bod prerušenia zdrojového kódu"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Pridať bod prerušenia"

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Pridať aktívnu jednotku do balíčka"

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Pridať bod skoku do histórie"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Pridať z editora do projektu"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Pridať pozorovanie ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Vybudovať"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Vybudovať všetko"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Vybudovať súbor"

#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "Vybudovať Lazarus"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr ""

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Skontrolovať súbor LFM v editore"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Vyčistiť adresár ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Zatvoriť"

#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Zatvoriť všetky súbory editora"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Zatvoriť projekt"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Editor definícií CodeTools ..."

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Zhromaždiť súbory .po"

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Zakomentovať výber"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Voľby prekladača ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Dokončovanie kódu"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Vložiť $IFDEF..."

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Konfigurovať budovanie + Spustiť súbor ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfigurovať voliteľné komponenty ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Nastaviť externé nástroje..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Konfigurovať Vybudovanie Lazarus"

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Konfigurovať pomoc ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextovo závislá pomoc"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Konvertovať balíček Delphi na Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Konvertovať projekt Delphi na Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Konvertovať jednotku Deplhi na Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Konvertovať súbor DFM na LFM ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Konvertovať kódovanie projektov/balíčkov ..."

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopírovať"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Vytvoriť súbory FPDoc"

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Vytvoriť .po súbory"

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Vystrihnúť"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Okná ladenia"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Rozdiely"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Upraviť"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Šablóny kódu ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Upraviť kontextovo závislú pomoc"

#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Konfigurovať inštalované balíčky ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr ""

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Vytvoriť podmenu"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Zmazať zo šablóny ..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Zmazať položku"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Vložiť zo šablóny ..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Vložiť novú položku (za)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Vložiť novú položku (pred)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor menu"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Posunúť dole (alebo vpravo)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Posunúť hore (alebo vľavo)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Popis novej šablóny ..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Uložiť ako šablónu ..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Zvoliť menu:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Zvoliť šablónu:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Ukážka šablóny"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Uzavrieť výber ..."

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "P&rostredie"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Vyskúšať/Upraviť ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Oddeliť procedúru ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Súbor"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Nájsť"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Nájsť ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Nájsť druhý koniec bloku kódu"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Nájsť začiatok bloku kódu"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Nájsť deklaráciu na kurzore"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Nájsť odkazy na identifikátor ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Nájsť v &súboroch ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Ná&jsť ďalší"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Nájsť &predchádzajúci"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPCDoc"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Voľby prostredia ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Choď na direktívu include"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Choď na riadok ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Odhadni zle umiestnený IFDEF/ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Odhadni neuzavretý blok"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Pomoc"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "IDE interné"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Narastajúce hľadanie"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Zväčšiť odsadenie"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Položka ChangeLog"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Vložiť z mapy znakov"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Kľúčové slovo CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Aktuálny dátum a čas"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Všeobecné"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "GPL vyhlásenie"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "LGPL vyhlásenie"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Vložiť text"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Meno aktuálneho používateľa"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Skontrolovať ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Skočiť späť"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Skočiť dopredu"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Skoč na"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Skoč na ďalšiu záložku"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Skoč na ďalšiu chybu"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Skoč na predchádzajúcu záložku"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Skoč na predchádzajúcu chybu"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Výber na malé písmená"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Vytvoriť ResourceString ..."

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nový formulár"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nový ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Nový balíček ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nový projekt ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nový projekt zo súboru ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nová jednotka"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online pomoc"

#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Otvoriť ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Otvoriť súbor na kurzore"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Otvoriť načítaný balíček ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Otvoriť súbor balíčka (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Otvoriť balíček aktuálnej jednotky"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Otvoriť projekt ..."

#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Otvoriť posledné ..."

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Otvoriť nedávny balíček ..."

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Otvoriť nedávny projekt ..."

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "&Balíček"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Graf balíčkov ..."

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "Odkazy balíčkov ..."

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Vložiť"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Prerušiť"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Zoznam procedúr ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inšpektor projektu"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Voľby projektu ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Spustiť"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikovať projekt ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Rýchly preklad"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Rýchla kontrola syntaxe"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""

#: lazarusidestrconsts.lismenuquit
#, fuzzy
#| msgid "Quit"
msgid "&Quit"
msgstr "Skončiť"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Znova"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Odstrániť z projektu ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Premenovať identifikátor ..."

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Nahradiť"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "Na&hradiť ..."

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "Hlásenie chyby ..."

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Znova prezrieť zdrojové kódy FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Reštartovať debuger"

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Reštartovať"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Obnoviť"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "Sp&ustiť"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Spustiť súbor"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Parametre spustenia ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Spustiť po kurzor"

#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Uložiť"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Uložiť všetko"

#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Uložiť ako ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Uložiť projekt"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Uložiť projekt ako ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Hľadať"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Vybrať"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Vybrať všetko"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Vybrať blok kódu"

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Vybrať riadok"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Vybrať odsek"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Vybrať po zátvorku"

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Vybrať slovo"

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Nastav voľnú záložku"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr ""

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Zoradiť výber ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Krok dnu"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr ""

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Krok cez"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Zastaviť"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulátory výberu na medzery"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "O ..."

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Zatvoriť"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Obsah"

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopírovať"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Vystrihnúť"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Štandardné menu Upraviť"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Štandardné menu Súbor"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Štandardné menu Pomoc"

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Upraviť"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Skončiť"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Súbor"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Nájsť"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Nájsť ďalší"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Pomoc"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Nový"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Otvoriť"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Otvoriť nedávne"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Vložiť"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Znova"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Uložiť"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Uložiť ako"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Príručka"

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "Vrátiť"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr ""

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Nástroje"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Odkomentovať výber"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Späť"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Zmenšiť odsadenie výberu"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Výber na veľké písmená"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Zobraziť"

#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Zobraziť Editor ukotvenia"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Body prerušenia"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Zásobník volaní"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Prehliadač kódu"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Prieskumník kódu"

#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Zobraziť Paletu komponentov"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenty"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Záznam udalostí"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Výstup ladenia"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Formuláre ..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Zobraziť tlačítka IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "Zobraziť Históriu skokov ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Lokálne premenné"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Správy"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inšpektor objektov"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Prehliadač obmedzení"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Výsledky hľadania"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "&Zobraziť zdrojový kód"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor zdrojového kódu"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Zoznam ToDo"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Prepnúť formulár/jednotka"

#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Zobraziť závislosti jednotky"

#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Jednotky ..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Pozorovania"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Okno"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor správ"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Nenájdená metóda triedy"

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Chýbajúce udalosti"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Chýbajúce identifikátory"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Chýbajúce balíčky"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <meno autora> <contact>%sTáto knižnica je slobodný softvér; môžete ju distribuovať a/alebo upravovať podľa ustanovení GNU Library General Public License tak ako ju zverenila Free Software Foundation; buď verzie 2 Licencie alebo (podľa vašej voľby) akoukoľvek novšej verzie s nasledujúcimi úpravami:%sAko špeciálny výnimka, vlastníci autorského práva tejto knižnice Vám dovoľujú prepojiť túto knižnicu s nezávislými modulmi za účelom vytvorenia programov, pričom nezávisí na licencii týchto nezávislých modulov, a kopírovať a distribuovať výsledné programy za podmienok poskytnutých podľa Vášho rozhodnutia, ktoré sa môžu líšiť pre každý nezávislý modul. Nezávislý modul je modul, ktorý nie je odvodený alebo založený na tejto knižnici. Ak upravujete túto knižnicu, môžete rozšíriť túto výnimku pre svoju verziu knižnice, ale nie je to vaša povinnosť. Ak to nechcete urobiť, zmažte túto výnimku zo svojej verzie. %sTento program je distribuovaný v nádeji, že bude užitočný, ale BEZ AKEJKOĽVEK ZÁRUKY; dokonca aj bbez záruky MERCHANTABILITY alebo FITNESS FOR A PARTICULAR PURPOSE. Ďalšie podrobnosti hľadajte v GNU Library General Public License. %sKópi GNU Library General Public License máte získať spolu s touto knižnicou, ak nie napíšte Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""

#: lazarusidestrconsts.lismore
msgid "More"
msgstr "Viac"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "Presunúť stranu ..."

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Uložiť správy do súboru (*.txt)"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Konflikt mena"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Meno novej procedúry"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "nový"

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Nový predok"

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr ""

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nová trieda"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nová konzolová aplikácia"

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Vytvoriť nový program."

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Vytvoriť novú súbor editora.%sZvoľte typ."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Vytvoriť nový prázdny textový súbor."

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#, fuzzy
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "vytvára novú grafickú aplikáciu.%sSúbor programu je spravovaný Lazarom."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Vytvoriť novú jednotku Pascalu."

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#, fuzzy
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Vyztvoriť nový program.%sSúbor programu je spravovaný Lazarom."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Vytvoriť nový projekt.%sZvoľte typ"

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Vytvoriť nový štandardný balíček.%sBalíček je kolekcia jednotiek ak omponentov."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Vytvoriť novú jednotku s dátovým modulom."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#, fuzzy
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "Vytvoriť novú jednotku s rámcom"

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Vytvoriť novú jednotku s formulárom LCL."

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "Dediť od existujúceho komponentu"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nezvolená položka"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Prosím, najprv vyberte položku."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nové kódovanie:"

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr ""

#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "%s - (nový projekt)"

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr ""

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr ""

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Nie"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Bez záložných súborov"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Bez zmeny"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nie je vybratý kód"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Žiadne zdedené voľby prekladača"

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr ""

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "6iadne vybrané okno IDE"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "bez mena"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sžiadne"

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "žiadne"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "nie je vybratý žiadny uzol"

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr ""

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Nenájdená sekcia ResourceString"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Filter je zvyčajne regulárny výraz. Pri Jednoduchej syntaxi je 'a' normálny znak, '*' vystupuje ako čokoľvek, '?' nahrádza jeden znak a čiarka a bodkočiarka oddeľujú možnosti. Napríklad: Jednoduchá syntax *.pas;*.pp korešponduje s ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenájdená reťazcová premenná"

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Nie je projekt Delphi"

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Nie je jednotka Delphi"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr ""

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy FreePascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Poznámka: Nemožno vytvoriť šablónu definície pre zdrojové kódy Lazarus"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Neimplementované"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Zatiaľ neimplementované:%s%s"

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Zatiaľ neimplementované."

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nie teraz"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Vytvoriť"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Vytvoriť nový projekt"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Zvoľte typ rpojektu"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Počet konvertovaných súborov: %s"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - predvolené"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "cesta objektov"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr ""

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Vypnúť)"

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Pridať do obľúbených vlastností"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Zvoľte základnú triedu pre obľúbenú vlastnosť %s%s%s."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Trieda %s%s%s nenájdená."

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Odstrániť z obľúbených vlastností"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automaticky inštalovaný dynamicky"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "automaticky inštalovaný staticky"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Popis:"

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sPopis:  %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Meno súboru:  %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "inštalovaný dynamicky"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "inštalovaný staticky"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "chýbajúci"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "zmenený"

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Nie je vybraný balíček"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Otvoriť načítaný balíček"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Meno balíčka"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Prosím, vyberte balíček"

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Prosím vyberte balíček pre otvorenie"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "len na čítanie"

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Stav"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sTento balíček je nainštalovaný, ale nebol nájdený súbor lpk"

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sTento balíček bol vytvorený automaticky"

#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "&Ok"
msgid "&OK"
msgstr "&OK"

#: lazarusidestrconsts.lisold
msgid "old"
msgstr "starý"

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Starý predok"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Stará trieda"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Zapnúť)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hľadať len celé slová"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr ""

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Otvoriť ako súbor XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Otvoriť existujúci súbor"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Otvoriť súbor"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "Otvoriť súbor ..."

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Otvoriť %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Otvoriť balíček?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Otvoriť balíček %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Otvoriť súbor balíčka"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Otvoriť projekt?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Otvoriť projekt"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Znova otvoriť projekt"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Otvoriť súbor projektu"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Otvoriť symbolický odkaz"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Otvoriť cieľ"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Otvoriť súbor ako bežný zdrojový kód"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Otvoriť balíček %s?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Otvoriť projekt %s?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "alebo"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Prepísať jazyk. Napríklad --language=de. Pre možné hodnoty pozrite súbory v adresári languages."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sprepíše predvolený prekladač. napr. ppc386 ppcx64 ppcppc atď. predvolené je uložené v environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sprepisuje CPU projektu. napr. i386 x86_64 powerpc powerpc_64 atď. predvolené: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sprepisuje operačný systém projektu. napr. win32 linux. predvolené: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sprepisuje widgetset projektu. napr. gtk gtk2 qt win32 carbon. predvolené: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Prepísať súbor?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Prepísať súbor na disku"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Balíček"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Informácie o balíčku"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Meno balíčka začína s ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Meno balíčka obsahuje ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Balíček potrebuje inštaláciu"

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Balíčky pre nainštalovanie do IDE"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Súbor zdrojového kódu Pascalu"

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Jednotka pascalu"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr ""

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Cesta"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Prezerať"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Posunúť cestu dole"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Posunúť cestu hore"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Cesty šablón"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Prehľadávať cesty:"

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Vyberte adresár"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Pridať položku"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "Pridať do projektu"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Použiť zmeny"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Volá procedúru %sRegister%s zvolenej jednotky"

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Preložiť"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Preložiť všetko?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Preložiť balíček"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Voľby prekladača pre balíček %s"

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Voľby prekladača"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Vytvoriť Makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Upraviť Všeobecné voľby"

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Upraviť Voľby preloženia balíčka"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Vlastnosti súboru"

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Všeobecné voľby"

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Pomoc"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Inštalovať"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Inštalovať balíček do IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Neplatná maximálna verzia"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Neplatná minimálna verzia"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximálna verzia"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimálna verzia:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Zmenené: %s"

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Viac ..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Posunúť závislosť dole"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Posunúť závislosť hore"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Balíček %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Balíček %s%s%s bol zmenený.%sUložiť balíček?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "balíček %s neuložený"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Stránka: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Znova pridať závislosť"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Znova pridať súbor"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Len na čítanie: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Znova preložiť všetky vyžadované"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Vyčistiť a znova preložiť"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Znova preložiť tento a všetky vyžadované balíčky?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrované pluginy"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registrovať jednotku"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Odstrániť závislosť"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Odstrániť závislosť?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Odstrániť závislosť %s%s%s%sz balíčka %s%s%s?"

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Odstránené súbory (tieto položky nie sú uložené v súbore lpk)"

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Odstránené vyžadované balíčky (tieto položky nie sú uložené v v súbore lpk)"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Odstrániť súbor"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Odstrániť súbor?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Odstrániť súbor %s%s%s%sz balíčka %s%s%s?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Odstrániť zvolenú položku"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Vyžadované balíčky"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Uložiť zmeny?"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Uložiť balíček"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Maximálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Minimálna verzia %s%s%s nie je platná verzia balíčka.%s(platný príklad 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Odinštalovať"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Zobraziť zdrojový kód balíčka"

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Automaticky vytvorené"

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Nainštalované"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Inštalovať pri ďalšom štarte"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Zvolené balíčky sú vyžadované:"

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Načítané balíčky:"

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Balíček %s nenájdený"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sStav: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Odinštalovať pri ďalšom štarte"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Pridať voľby k závislostiam balíčkov a projektov"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Pridať cesty k závislým balíčkom/projektom"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Autor:"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Pri budovaní automaticky zvyšovať verziu"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automaticky prebudovať, keď je to potrebné"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automaticky prebudovať, pri prebudovaní všetkého"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Vlastné"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Popis/Zhrnutie"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Doba návrhu i spustenia"

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Len doba návrhu"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrácia IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Zahrnúť"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Neplatný typ balíčka"

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "Cesta k súborom FPDoc"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Knižnica"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Licencia:"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linkovač"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Hlavná"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Manuálny preklad (nikdy automaticky)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Nižšia"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objekt"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Voľby balíčka"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Typ balíčka"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Poskytuje"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Vydanie"

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Len pre dobu spustenia"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Balíček %s%s%s má nastavený príznak autoinštalácie.%sTo znamená, že bude inštalovaný v IDE. Inštalačné balíčky %smusia byť balíčkami doby návrhu."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Tento balíček poskytuje to isté ako balíčky:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Aktualizovať/Prebudovať"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Použitie"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Zrušiť"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Postup"

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Nájdený konflikt"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Upraviť virtuálnu jednotku"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Meno súboru:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Opraviť veľkosť písmen"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Neplatné meno jednotky"

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Posunúť súbor dole"

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Posunúť súbor hore"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "Zoradiť súbory"

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Jednotka s týmto menom už existuje.%sSúbor: %s"

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Meno jednotky nie je platný identifikátor Pascalu."

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Meno jednotky je použité keď IDE rozširuje klauzuly uses."

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Meno jednotky:"

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Meno jednotky a meno súboru nesúhlasia.%sNapríklad: unit1.pas a Unit1"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Doplnenie CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Výstupný adresár"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Značka zdrojového adresára balíčka"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Cesta jednotky"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Naozaj chcete zahodiť všetky zmeny balíčka %s a znova načítať súbor?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nová jednotka nie je v ceste jednotiek"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikovať balíček"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Obnoviť balíček?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Súbor %s%s%s%smomentálne nie je v ceste jednotiek balíčka.%s%sPridať %s%s%s do cesty jednotiek?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online pomoc zatiaľ nie je implementovaná"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Kliknutie pravým tlačítkom na strom položiek, sprístupní všetky dostupné funkcie balíčka."

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Ďalšie funkcie sú vo vyskakujúcom menu"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Binárny"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Súbor include"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Spravoanie súboru XML"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - textový formulár Lazarus"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus resource"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuálna jednotka"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sPridanie novej závislosti balíčka %s: balíček %s%s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sPridanie novej závislosti projektu %s: balíček %s%s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Pridať jednotku do klauzuly uses balíčka. Toto vypnúť len pre jednotky, ktoré nemusia byť prekladané vo všetkých triedach."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Nájdená nejednoznačné jednotky"

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Vyžadovaný balíček nebol nájdený. Pozrite Graf balíčkov."

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automaticky inštalované balíčky"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sOba balíčky sú spojené. To znamená, že jeden balíček používa druhý alebo sú oba použité tretím balíčkom."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Porušená závislosť"

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Zacyklené závislosti balíčka"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Zmazanie zlyhalo"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Zmazať súbor starého balíčka?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Zmazať starý súbor balíčka %s%s%s?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Závislosť bez vlastníka: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Chyba čítania súboru"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Chyba čítania balíčka"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Chyba zapisovania súboru"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Chyba zápisu balíčka"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Súbor už v balíčku existuje"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Súbor je v projekte"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Meno súboru je iné ako z mena balíčka"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Meno súboru je použité iným balíčkom"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Meno súboru je použité projektom"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Súbor %s%s%s nenájdený."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Súbor neuložený"

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Ignorovať a uložiť balíček teraz"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíček:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Inštalácia balíčka %s automaticky nainštaluje balíčky:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "neplatné meno súboru preladača"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Neplatná prípona súboru"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Neplatná prípona súboru balíčka"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Neplatné meno súboru balíčka"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Načítanie balíčka %s nahradí balíček %s%szo súboru %s.%sStarý balíček je upravený.%s%sUložiť starý balíček %s?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Nový balíček"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Balíček: %s"

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Balíček %s%s%s zmenený. Uložiť?"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Konflikty balíčka"

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Chýba súbor balíčka"

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Balíček %s%s%s má neplatný výstupný adresár:%s%s%s%s"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Balíček nie je pre dobu návrhu"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Balíček je vyžadovaný"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "základný súbor zdrojového kódu balíčka"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Meno balíčka už existuje"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Balíčky musia mať príponu .lpk"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Prosím, uložte súbor pred jeho pridaním do balíčka."

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Prosím najprv uložte balíček."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Prebudovať Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Premenovať súbor v balíčku?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Nahradiť existujúci súbor %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Nahradiť súbor"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Uložiť balíček?"

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Uložiť balíček?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Uložiť balíček %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Má byyť súbor premenovaný malými písmenami na %s%s%s%s?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Preskočiť tento balíček"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "konfiguračný súbor statických balíčkov"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Súbor prekladača pre balíček %s nie je platný spustiteľný súbor:%S%S"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Súbor %s%s%s%suž je v balíčku %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Súbor %s%s%s nie je balíček Lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Meno súboru %s%s%s nesúhlasí s menom balíčka %s%s%s v súbore.%sZmeňte menobalíčka na %s%s%s?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Meno súboru %s%s%s je časťou aktuálneho projektu.%sProjekty a balíčky nemôžu zdieľať súbory."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Meno súboru %s%s%s je použité %sbalíčka %s%s%s%sv súbore %s%s%s."

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Súbor %s%s%s%sbalíčka %s chýba."

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Súbor %s%s%s%sbalíčka %s treba najprv uložiť."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Zlyhalo načítanie týchto balíčkov:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sNasledujúce jednotky budú pridané do sekcie uses %s%s:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Balíček %s%s%s pri inštalácii zlyhal.%sOdstrániť ho z inštalačného zoznamu?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Meno súboru balíčka %s%s%s v%s%s%s%s nie je platné meno balíčka Lazarus."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Balíček %s je balíčkom len pre dobu behu. %sBalíčky len pre dobu behu nemožno inštalovať do IDE."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Balíček %s%s%s je označený na inštaláciu, ale nádá sa nájsť.%sOdstrániť závislosť zo zoznamu inštalovaných balíčkov?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Balíček %s je vyžadovaný balíčkom %s, ktorý je označený pre inštaláciu.%sViz graf balíčkov."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Meno balíčka %s%s%s nie je platným menom balíčka%sProsím zvoľte iné meno (napr. balicek1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Meno balíčka %s%s%s %ssúboru %s%s%s je neplatné."

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Balíček %s vlastní súbor %s%s%s%s.%sMá byť súbor premenovaný aj v balíčku?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s bol označený na odinštaláciu.%sMomentálne Lazarus podporuje builen staticky pripojené balíčky, preto odinštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Balíček %s%s%s bol označený na inštaláciu.%sMomentálne Lazarus podporuje len staticky pripojené balíčky, preto inštalácia vyžaduje prebudovanie a reštart Lazarus.%s%sChcete teraz prebudovať Lazarus?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Projekt vyžaduje balíček %s%s%s.%sAle tento nebol nájdený. Pozrite Projekt -> Inšpektor projektu."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Existujú dve jednotky s rovnakým menom:%s%s1. %s%s%s z %s%s2. %s%s%s z %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Vyžadované balíčky sú zacyklené. Pozrite graf balíčkov."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Existuje jednotka FPC s rovnakým menom ako balíček:%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Už existuje jednotka FPC s rovnakým menom ako %s%s%s%s%s z %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Balíček so zvoleným menom %s%s%s.%suž existuje. Konfliktný balíček: %s%s%s%sSúbor: %s%s%s."

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Balíček %s%s%s načítaný %szo súboru %s%s%s už existuje.%sPozrite Balíček -> Graf balíčkov .%sNahradenie nie je možné."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Medzi vyžadovanými balíčkami sú neuloýené balíčky. Pozrite graf balíčkov."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Už existuje jednotka s rovnakým enom ako blíček:%s%s1. %s%s%s z %s%s2. %s%s%s%s"

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Toto je virtuálny balíček. Zatiaľ nemá zdrojový kód. Prosím najprv uložte balíček."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Nemožno vytvoriť adresár"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Nemožno vytvoriť výstupný adresár %s%s%s%sbalíčka %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Nemožno vytvoriť zdrojový adresár %s%s%s%spre balíček %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Nemožno vytvoriť cieľový adresár pre Lazarus:%s%s%s%s.%sTento adresár je potebný pre nové, zmenené Lazarus IDE s vašimi balíčkami."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Nemožno zmazať súbor %s%s%s."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Nemožno zmazať súbor"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Nemožno zmazať starý stavový súbor %s%s%s%sbalíčka %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Nemožno otvoriť balíček %s%s%s.%sTento balíček bol označený na inštaláciu."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nemožno čítať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Nemožno zapísať balíček %s%s%s%sdo súboru %s%s%s.%sChyba: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Nemožno zapísať stavový súbor %s%s%s%sbalíčka %s.%sChyba: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Odinštalovať balíček?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Odinštalovať balíček %s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Neuložený balíček"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Použiť jednotku"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Upozornenie: Súbor %s%s%s%spatrí do aktuálneho projektu."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "Registrácia balíčka"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Nemožno registrovať komponent bez jednotky"

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - nástroje pre spracovanie, prechádzanie a úpravu zdrojových kódov Pascalu"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Trieda komponentu %s%s%s je už definovaná"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sMeno súboru: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Neplatná trieda komponentu"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Neplatné meno jednotky: %s"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Súbor balíčka nenájdený"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Procedúra Register je prázdna"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Bolo volané RegisterUnit, ale neregistruje sa žiadny balíček."

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Chyba registrácie"

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - komponent editora použitý Lazarom. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - FreePascal Component Library poskytuje základné triedy pre Object Pascal."

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Lazarus Component Library obsahuje všetky základné komponenty pre úpravu formulárov."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Balíček %s%s%s je nainštalovaný, ale nebol nájdený platný súbor balíčka (.lpk).%sBol vytvorený poškodený fiktívny balíček."

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - Run-Time Library je základ všetkých programov Free Pascal."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Toto je predvolený balíček. Určený len pre komponenty bez balíčkov (zastarané)."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Tento balíček je nainštalovaný, ale súbor lpk nebol nájdený. Všetky jeho komponenty sú deaktivované. Prosím opravte to."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sMeno jednotky: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Jednotka nenájdená: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Jednotka %s%s%s bola z balíčka odstránená"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Tento súbor nepatrí do žiadneho načítaneho balíčka."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Nemožno čítať súbor balíčka  %s%s%s.%sChyba: %s"

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Existuje"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Globálne"

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Len existujúce súbory"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Odkazy balíčkov"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Zobraziť globálne odkazy"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Zobraziť používateľské odkazy"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Používateľ"

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Prosím pred spustením otvorte jednotku."

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr ""

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Prosím vyberte kód pre oddelenie procedúry/metódy"

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Všetko>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Zmeniť font"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Kopírovať meno metódy do schránky"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrovanie s porovnávaním akejkoľvek časti metódy"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrovanie s porovnávaním začiatku metódy"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Skoč na výber"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nič>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objekty"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Neukladať žiadne informácie o relácii"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Ukazovateľ"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Uložiť v konfiguračnom adresári IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Uložiť do súboru .lps"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Uložiť do súboru .lps v adresári projektu"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Informácie o relácii uložiť v"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "hlavný konfiguračný adresár, kde Lazarus uchováva svoje konfiguračné súbory. Predvolené je "

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Tlačiť"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Súkromné (private)"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Súkromná metóda"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Pred pokračovaním asi bude potrebné nainštalovať niektoré balíčky .%s%sUpozornenie:%sProjekt závisí na niektorých balíčkoch, ktoré obsahujú jednotky s procedúrou Register. Procedúra Register je bežne používaná na inštaláciu komponentov v IDE, ale nasledujúce jednotky vyzerajú akoby patrili do balíčkov, ktoré zatiaľ v IDE nainštalované nie sú. Ak sa pokúsite otvoriť v IDE formulár, ktorý používa takéto komponenty, dostanete chyby o chýbajúcich komponentoch a načítanie formulára môže vyvolať neočakávané správanie.%s%sToto nemá vplyv na otváranie súborov projektu alebo jeho zdrojových kódov.%s%sZnamená to len, že nie je dobrý nápad otvárať formulár v návrhovom zobrazení pred nainštalovaní chýbajúcich balíčkov.%s%s"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedúra"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedúra s rozhraním"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#, fuzzy
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Program%sFreePascal program. Súbor programu je automaticky spravovaný Lazarom."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program zistený"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Zdrojový kód programu musí mať príponu Pascalu ako .pas, .pp or .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr ""

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Pridať súbor do projektu:"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Závislosť už existuje"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Pridať súbory editora"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Pridať súbory"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Neplatná Min-Max verzia"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Neplatné meno balíčka"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Neplatné meno jednotky pascal"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Neplatná verzia"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maximálna Verzia (voliteľné):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimálna verzia (voliteľné)"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nový vyžadovaný"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Meno balíčka:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Balíček nenájdený"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Závislosť %s%s%s nebola nájdená.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Maximálna verzia %s%s%s je neplatná.%sProsím použite formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maximálna verzia je nižšia ako Minimálna."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Minimálna·verzia·%s%s%s·je·neplatná.%sProsím·použite·formát hlavné.vedľajšie.uvoľnenie.vybudovanie%sNapríklad: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Meno balíčka %s%s%s je neplatné.%sProsím zvoľte existujúci balíček."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Projekt už má závislosť na balíčku %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Meno jednotky %s%s%s už v projekte existuje %sso súborom: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Meno jednotky %s%s%s už existuje vo výbere%sso súborom: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Meno jednotky %s%s%s nei je platný identifikátor Pascalu."

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Pridať do projektu"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Meno jednotky už existuje"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt zmenený"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Adresár projektu"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Meno súboru projektu"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Cesta k include projektu"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Informačný súbor projektu zistený"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Informácie o projekte"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt je spustiteľný"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Vlastnosti Makier projektu"

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "makro ProjectUnitPath"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr ""

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Cesta k zdrojovým kódom projektu"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#, fuzzy
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Projekt %s%s%s úspešne vybudovaný. :)"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Cesta k jednotkám projektu"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Sprievodca projektom"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Potvrďte zmazanie závislosti"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Zmazať závislosť pre %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inšpektor projektu - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Odstránené vyžadované balíčky"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Odstrániť súbor %s z projektu?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Nemožno čítať stavový súbor %s projektu %s%sChyba: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Nemožno zapísať stavový súbor projektu %s%sChyba: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Vždy vybudovať (aj keď nezmenené)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Chyba"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Nemožno zmeniť zoznam automaticky vytváraných formulárov v zdrojovom kóde programu.%sNajprv opravte chyby."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Značka zdrojového adresára projektu"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Opýtať sa na hodnotu"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr ""

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Chránené (protected)"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Chránená metóda"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Verejná metóda"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Zverejnená metóda"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Publikovať adresár projektu"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Neplatný vylučovací filter"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Neplatný zahrňovací filter"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Jednotka Pascalu musí mať príponu .pp alebo .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Upraviť virtuálnu jednotku"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Už existuje jednotka s týmto menom.%sSúbor: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Meno jednotky nie je platný identifikátor Pascalu"

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Meno jednotky je použité, keď IDE pridáva do klauzulí uses."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Meno jednotky a meno súboru nesúhlasia.%sPríklad: unit1.pas a Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Konvertovať projekt Delphi"

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Nový projekt"

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Otvoriť projekt"

#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Otvoriť nedávne"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr ""

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Skončiť Lazarus"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Chyba čítania"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Záznam/Štruktúra"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Meno"

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Regulárny výraz"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relatívne cesty"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "odstrániť"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Odstrániť všetky neplatné vlastnosti"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr ""

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Odstrániť z projektu"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr ""

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr ""

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Odstrániť ich"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr ""

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Premenovať súbor?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Premenovanie súboru zlyhalo"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Premenovať na malé písmená"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Znova otvoriť s iným kódovaním"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Počet opakovaní:"

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Nahradenie výberu zlyhalo."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/sk"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr ""

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Chyba načítania resource"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Chyba uloženia resource"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr ""

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr ""

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr ""

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr ""

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Obnovenie zlyhalo"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "šípka vpravo"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Pravé ukotvenie"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Pravý okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·vprav od prvku."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·pravej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Pravé strany"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Rovnaká pravá vzdialenosť"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Súbor nie je spustiteľný"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Hostiteľská aplikácia %s%s%s nie je spustiteľná."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Spustiť po zlyhané"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Abstraktné metódy - zatiaľ neprepísané"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Abstraktné metódy %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Kurzor nie je v definícii triedy"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE pracuje"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s je abstraktná trieda a má %s abstraktných metód."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Abstraktné metódy nenájdené"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Nahradiť všetky vybraté"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Nahradiť prvý vybratý"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Nič vybraté"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existuje %s abstraktných metód, ktoré možno prepípsať.%sZvoľte metódy, pre ktoré majú byť vytvorené kostry:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Neexistujú abstraktné metódy na prepísanie."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Táto metóda nemôže byť prepísaná, pretože je definovaná v aktuálnej triede"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nemožno zobraziť abstraktné metódy tejto triedy, pretože"

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Uložiť ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Uložiť všetky správy do súboru"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "uložiť všetky zmenené súbory"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Uložiť a skončiť dialóg"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Uložiť a prebudovať IDE"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Uložiť zmeny?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Uložiť zmeny do projektu %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "uložiť aktuálny súbor editora"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Uložiť informácie editora o súboroch, ktoré nepatria do projektu"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Uložiť súbor ako"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Uložiť súbor %s%s%s%spred zatvorením formulára %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Uložiť informácie o zatvorených súboroch editora"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Uložiť nastavenia"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Uložiť"

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Mierka:"

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Hľadať"

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr ""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "druhý konfiguračný adresár, v ktorom Lazarus hľadá súbory konfigurácie šablón. Predvolený je "

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Pozri správy."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sPozrite Projekt -> Inšpektor projektu"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Vyberte položku pomoci:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Zvoľte uzol"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Zvoľte súbory formulárov Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Vybrať súbor"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Výber presahuje reťazcovú konštantu"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Nástroj výberu"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr ""

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Nastaviť predvolené"

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr ""

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr ""

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr ""

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Krátky:"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Zobraziť"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr ""

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Zobraziť gutter"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Zobraziť rady v Inšpektore objektov"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Zobraziť identifikátory"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Zobraziť staré poradie záložiek"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Zobraziť balíčky"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Zobraziť špeciálne znaky"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "zobrazí verziu a skončí"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Skrátiť na najmenšie"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Súrodenec"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Jednoduchá syntax"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Preskočiť súbor a pokračovať v načítaní"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Preskočiť otváranie posledného projektu"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "radšej menšie ako rýchlejšie"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Vhovujúce"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Prepáčte, tento typ zatiaľ nie je implementovaný"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Vzostupne"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Zrušiť"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Citlivé na veľkosť"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Zostupne"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Doména"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorovať medzery"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Riadky"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Voľby"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Odseky"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Ukážka"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Prijať"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Zoradiť výber"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Slová"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Zdroj a cieľ sú rovnaké: %s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "&Zdrojový bod prerušenia"

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Zdrojový adresár %s%s%s%sa cieľový adresár %s%s%s%ssú tie isté.%s%sMožno ste nepochopili túto funkciu.%sFunkcia vyčistí/znovavytvorí cieľový adresár %sa kopíruje do neho balíček/projekt."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Adresár zdrojových kódov %s%s%s neexistuje."

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Zdrojový kód zmenený"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Zdrojový kód stránky %s%s%s bol zmenený. Uložiť?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Cesty zdrojových kódov"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Rovnaká medzera"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Zdrojový OS"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Hľadanie"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Hľadaný text"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Začať nový projekt"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Zastaviť aktuálne ladenie a prebudovať projekt?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Zastaviť pri výnimke"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Zastaviť ladenie?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr ""

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Chyba streamu"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Chyba streamovania"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Reťazec"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Štýl"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Podprocedúra"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Podprocedúra na rovnakej úrovni"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Úspešné"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revízia SVN: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Neplatné meno premennej"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s nie je platný identifikátor."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Prepísať systémovú premennú"

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Mód syntaxe"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tabulátor"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Poradie pre tabulátor"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Cieľový CPU"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Meno súboru cieľového projektu"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Cieľový OS"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Interná chyba prekladača! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testovací adresár"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr ""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Trieda %s%s%s je TControl a môže byť vložená len do ovládacieho prvku.%sNemožno vložiť."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "CodeTools našiel chybu:%s%s%s"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Príkaz za %s%s%s nie je spustiteľný."

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Príkaz pred publikovaním je neplatný:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Komponent %s nemožno zmazať, pretože nie je vlastnený %s."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Editor komponentu triedy %s%s%s vytvoril chybu:%s%s%s%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Editor komponentu triedy %s%s%s%svyvolaný príkazom #%s %s%s%s%svytvoril chybu:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Komponent %s je dedí od %s.%sPre zmazanie dedeného komponentu otvorte predka a zmažte ho tam."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr ""

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálne meno súboru prekladača %s%s%s%snie je platný spustiteľný súbor.%sZvoľte OK nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Aktuálne menu súboru prekladača %s%s%s%snie je platný spustiteľný súbor.%sProsím, skontrolujte Prostredie -> Voľby prostredia -> Súbory"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár zdrojových kódov Free %s%s%s%snevyzerá správne.%sZvoľte OK pre nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár zdrojových kódov Free Pascal %s%s%s%snevyzerá správne.%sSkontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár Lazara %s%s%s%snevyzerá správne.%sBez neho nebudete môcť vytvárať LCL aplikácie.%sZvoľte OK pre nastavenie predvoleného %s%s%s.%sInak skontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Aktuálny adresár Lazara %s%s%s%snevyzerá správne.%sBez neho nebudete môcť vytvárať LCL aplikácie.%sSkontrolujte Prostredie->Voľby·prostredia->Súbory"

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Aktuálna cesta jednotiek pre súbor %s%s%s%s je%s%s%s%s.%s%sCesta k jednotkám LCL %s%s%s chýba.%s%sRada pre neskúsených:%sVytvorte aplikáciu Lazarus a vložte súbor do adresára projektu."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Debuger %s%s%s%sneexistuje, alebo nie je spustiteľný.%s%sPozrite Prostredie -> Voľby debugera"

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Cieľový adresár  %s%s%s%s neexistuje."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Cieľový adresár %s%s%s neexistuje.%sProsím skontrolujte cieľové meno súboru projektu v Projekt > Voľby projektu."

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Adresár %s%s%s nie je viac potrebný v ceste jednotiek.%sOdstrániť ho?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr ""

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Adresár %s%s%s zatiaľ nie je v ceste jednotiek.%sPridať ho?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Nenájdený adresár %s."

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Súbor %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr ""

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Súbor %s%s%s je symbolický odkaz. %s%sOtvoriť %s%s%s namiesto neho?"

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Súbor %s%s%s nie je Delphi projekt (.dpr)"

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Súbor %s%s%s nie je jednotka Delphi."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr ""

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Súbor %s%s%s%svyzerá byť programom. Zatvoriť aktuálny projekt a vytvoriť nový projekt Lazarus z tohoto programu?%s\"Nie\" načíta súbor ako bežný zdrojový kód."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Súbor %s vyzerá byť programovým súborom existujúceho projektu Lazarus."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Súbor %s%s%s%sbol nájdený v jednom zo zdrojových adresárov balíčka %s a vyzerá ako preložená jednotka. Preložené jednotky musia byť vo výstupnom adresári balíčka, inak môžu mať iné balíčky problémy s použitím tohoto balíčka.%s%sZmazať tento súbor?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Súbor %s%s%s%snebol nájdený.%sChcete ho nájsť sám?%s"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Súbor %s%s%s%snebol nájdený.%sZvoľte Ignorovať pre pokračovanie v načítaní projektu,%sZvoľte Zrušiť pre zastavenie načítania."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Nasledujúce metódy použité v %s nie sú v zdrojovom kóde%s%s%s%s%s%sOdstrániť tieto odkazy?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Prekladač FreePascal (meno súboru: %s) nebol nájdený.%sDoporučujeme nainštalovať fpc."

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Adresár·zdrojových kódov Free Pascal nebol nájdený.%sNiektoré funkcie kódu nebudú pracovať.%sDoporučujeme ich nainštalovať a nastaviť cestu v %sProstredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr ""

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Kláves %s%sis už je priradený k %s.%s%sOdstrániť staré priradenie a priradiť kláves novej funkcii%s%s?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Program %s%spotrebný pre spustenie neexistuje alebo nie je spustiteľný.%sChcete ho vytvoriť?%s%sViz nastavenia v Projekt -> Voľby projektu -> Aplikácia."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Spúšťacia aplikácia %s%s%s%sneexistuje alebo nie je spustiteľná.%s%sViz Spustiť -> Parametre spustenia -> Lokálne"

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Adresár Lazara enbol nájdený.%sNebudete môcť vytvárať LCL aplikácie.%sProsím skontrolujte Prostredie->Voľby prostredia->Súbory"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Súbor LFM (formulár Lazarus) obsahuje neplatné vlastnosti. To znamená, napríklad, že obsahuje nejaké vlastnosti/triedy, ktoré neexistujú v aktuálnom LCL. Štandardná oprava je odstrániť tieto vlastnosti z lfm a ručne opraviť kód Pascalu."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Meno %s%s%s nie je platný identifikátor Pascalu."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Nová jednotka zatiaľ nie je v ceste hľadaní jednotiek.%sPridať adresár %s?"

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Výstupný adresár %s%s%s chýba."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Výstupný adresár %s je v zozname ciest hľadania include %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Výstupný adresár %s je v zdedenom zozname ciest hľadania include %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Výstupný adresár %s je v zozname zdedených ciest hľadania is jednotiek %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Výstupný adresár %s je v zozname ciest hľadania jednotiek%s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "Výstupný adresár musí byť samostatný adresár a nesmie obsahovať žiadne zdrojové súbory."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Balíšek už obsahuje jednotku s takýmto menom"

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Program %smake%s nebol nájdený.%sTento nástroj je potrebný na prebudovanie Lazarus.%s"

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr ""

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Informačný súbor projektu %s%s%s%sje zhodný so záladným súborom zdrojového kódu!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr ""

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Pred vybudovaním musíte projekt uložiť%sAk ste nastavili testovací adresár vo voľabch prostredia,%smôžete nový projekt naraz vytvoriť a vybudovať.%sUložiť projekt?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "V adresári sú iné súbory s rovnakým menom,%s%sktoré sa líšia len veľkosťou písmen:%s%s%sZmazať ich?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Na disku už je súbor s rovnakým menom a podobnou koncovkou%sSúbor: %s%sNeplatný súbor: %s%s%sZmazať neplatný súbor?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr ""

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Formulár s menom %s%s%suž existuje"

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Jednotka s menom %s%s%suž existuje. Identifikátory Pascal musia byť unikátne."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Jednotka s menom %s%s%s už v projekte existuje.%s"

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Zdrojová trieda %s%s%s pochádza z %s%s%s. Možno je to preklep pre TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Pri zápise zvoleného komponentu nastala chyba %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Pri konvertovaní binárneho streamu zvoleného kompoenntu nastala chyba %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Pri kopírovaní streamu komponentu dos chránky nastala chyba:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Koreňový komponent nemôže byť zmazaný."

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Jednotka %s%s%s už existuje.%sIgnorovať vynúti premenovanie,%sCancel zruší ukladanie tohoto zdrojového kódu a %sAbort zruší celé ukladanie."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Jednotka %s existuje dvakrát v ceste jednotiek %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Meno súboru jednotky %s%s%s nie je malými písmenami.%sPrekladač FreePascal nehľadá všetky veľkosti. Je lepšie použiť mena súborov s malými písmenami.%s%sPremenovať súbor malými písmenami?"

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Jednotka samotná už má meno%s%s%s. Identifikátory Pascalu musia byť unikátne."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Cesta hľadania jednotiek %s%s%s obsahuje zdrojový adresár %s%s%s balíčka %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Pracovný adresár %s%s%s neexistuje.%sProsím skontrolujte pracovný adresár v Spustiť > Parametre spustenia."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "táto pomocná správa"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Vyzerá to ako pascalovský súbor.%sOdporúčame v·mene použiť malé písmená, aby ste predišli problémom na niektorých súborových systémoch a rôznych prekladačoch.%sPremenovať malými písmenami?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Tento príkaz nemôže byť vytiahnutý.%sProsím vyberte nejaký kód pre vytiahnutie procedúry/metódy."

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr ""

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr ""

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr ""

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Nadpis"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titulok (nechajte prázdne pre predvolený)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funkcia: pripojiť oddeľovač cesty"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funkcia: odstrániť oddeľovač cesty"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funkcia: vybrať príponu súboru"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funkcia: vybrať meno súboru + príponu"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funkcia: vybrať len meno súboru"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funkcia: vybrať cestu súboru"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(neznáme makro: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Cesty:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Prepnúť zobrazenie mien súborov s absolútnou alebo relatívnou cestou"

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr ""

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Hore"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Horné zarovnanie"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Horný·okraj.·Táto·hodnota·je·pridaná·k·základnému·okraju·a·použitá·pre·medzeru·nad·prvkom."

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Horné okraje"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Toto·je·súrodenec·prvku,·ku·ktorého·hornej·strane·je·ukotvený.·Ponechajte·prázdne·pre·rodiča"

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Rovnaká horná medzera"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Túto správu už nezobrazovať."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Chyba v regulárnom výraze"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Font bez UTF-8"

#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Choď na riadok:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nenájdené"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Nahradiť tento výskyt %s%s%s%s týmto %s%s%s?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Hľadanie: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Hľadaný reťazec '%s' nenájdený!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Aktuálny font editora nepodporuje UTF-8, ale systém vyzerá, že ho používa.%sTo znamená, že ne ASCII znaky môžu byť zobrazené nesprávne.%sMôžete si vybrať iný font vo voľbách editora."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Vymazať vyrovnávaciu pamäť include"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bajtov"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Vymazať"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Vložil:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "v projekte:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Riadky:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Meno:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nie"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Cesty (len na čítanie)"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Veľkosť:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Zdroj"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Jednotka"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "áno"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Zobraziť hodnoty CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Nemožno konvertovať binárny strom na text"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Nemožno kopírovať komponenty do schránky"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nemožno pridať komentár hlavičky resource do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Nemožno pridať resource T%s:FORMDATA do súboru resource %s%s%s%s.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr ""

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Do projektu nemožno pridať %s, pretože projekt už obsahuje jednotku s rovnakým menom."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Nemožno zálohovať súbor %s%s%s na %s%s%s!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sNemožno zmeniť triedu %s na %s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Nemožno vyčistiť cieľový adresár"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Nemožno vyčistiť %s%s%s.%sProsím skontrolujte prístupové práva."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Nemožno konvertovať text komponentu do binárneho formátu:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Nemožno konvertovať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Nemožno konvertovať lfm na lrs a zapísať súbor lrs"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Nemožno konvertovať textové dáta formulára súboru %s%s%s%s%sdo binárneho streamu. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Nemožno kopírovať súbor"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Nemožno prekopírovať súbor %s%s%s%sdo %s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Nemožno prekopírovať súbor %s%s%s%sdo %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Nemožno vytvoriť záložný adresár %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Nemožno vytvoriť adresár %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Nemožno vytvoriť adresár %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Nemožno vytvoriť súbor"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Nemožno vytvoriť súbor %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Nemožno vytvoriť súbor %s%s%s."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Nemožno vytvoriť odkaz %s%s%s s cieľom %s%s%s"

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Nemožno vytvoriť novú metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Nemožno vytvoriť dočasný LFM bufer"

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Nemožno zmazať poškodený súbor %s%s%s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Nemožno nájsť platné meno triedy v %s%s%s"

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Nemožno nájsť súbor %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "Nemožno nájsť súbor %s%s%s.%sAk patrí do Vášho projektu, skontrolujte cestu hľadaní v %sProjekt->Voľby prekladača ...->Cesty ->Ostatné súbory jednotiek. Ak tento súbor patrí do balíčka, skontrolujte príslušné voľby prekladača balíčka. Ak tento súbor patrí do Lazara, overte vyčistenie prekladu. Ak súbor patrí do FPC, potom skontrolujte fpc.cfg. Ak si nie ste istí, použite Projekt->Voľby prekladača ...-> Test"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Nemožno nájsť %s v streame LFM."

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Nemožno nájsť metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Nemožno nájsť jednotku triedy komponentu %s%s%s."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Nemožno získať zmeny editora."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Nemožno získať zdrojový kód pre návrhára."

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Nemožno načítať starý resource súbor.%sResource súbor je prvý include súbor v sekcii %sinitialization.%sNapríklad {$I %s.lrs}.%sPravdepodobne syntaktická chyba."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Nemožno načítať triedu komponentu %s%s%s, pretože závisí sama na sebe."

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Nemožno otvoriť predka komponentu"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Nemožno otvoriť návrhára.%sTrieda %s nie je potomkom triedy ako TForm alebo TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Nemožno čítať %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Nemožno čítať súbor"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Nemožno čítať súbor %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Nemožno čítať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Nemožno čítať súbor %s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Nemožno odstrániť starý záložný súbor %s%s%s!"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Nemožno premenovať poškodený súbor %s%s%s%sna %s%s%s"

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Nemožno premenovať súbor"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Nemožno premenovať súbor %s%s%s na %s%s%s!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Nemožno premenovať súbor %s%s%s%sna %s%s%s."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nemožno premenovať formulár v zdrojovom kóde"

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Nemožno premenovať metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Nemožno premenovať premennú v zdrojovom kóde."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Nemožno spustiť"

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Nemožno uložiť súbor %s%s%s"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Nemožno nastaviť AnchorSide prvku"

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Nemožno zobraziť metódu, prosím opravte chyby zobrazené v okne správ."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Nemožno streamovať vybraté komponenty"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Nemožno streamovať vybraté komponenty"

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Nemožno streamovať %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Nemožno transformovať binárny stream komponentu %s:T%s na text."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Nemožno vytvoriť príkaz CreateForm v zdrojovom kóde projektu"

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Nemožno aktualizovať binárny súbor zdrojov %s%s%st textového súbora zdrojov %s%s%s%sTextový súbor je asi poškodený."

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Nemožno zapísať %s%s%s%s%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Nemožno zapísať %s%s%s"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Nemožno zapisovať do súboru"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Nemožno zapísať súbor %s%s%s%sChyba: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Nemožno zapisovať do súboru %s%s%s!"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Nemožno zapísať xml stream do %s%sChyba: %s"

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr ""

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Odinštalovať výber"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identifikátor jednotky existuje"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s jednotka %s v balíčku %s%s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Meno jednotky už v projekte existuje"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Meno jednotky začína s ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Meno jednotky obsahuje ..."

#: lazarusidestrconsts.lisunitnotfound
#, fuzzy
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Jednotka nenájdená"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Výstupný adresár jednotky"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "cesta jednotiek"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Cesty jednotiek"

#: lazarusidestrconsts.lisunitsnotfound2
#, fuzzy
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Jednotky nenájdené"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr ""

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr "Ukáža aktualizácie"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Správa o použití (voľba -h)"

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr ""

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Použiť vylučovací filter"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Použiť zahŕňací filter"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Spúšťanie aplikácie"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Domovský adresár používateľa"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr ""

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Overiť volania metód"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Verzia"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Zvislo"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Kopírovať informácie o verzii do schránky"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Zobraziť jednotky projektu"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Zobraziť zdrojový kód (.lfm)"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Hľadať dopredu"

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Vymazať zoznam výsledkov"

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Upozornenie: Nájdený nejednoznačný súbor: %s%s%s. Zdrojový kód je: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Pozorovať vlastnosti"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr ""

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr ""

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "S vyžadovanými balíčkami"

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Pridať"

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Zmazať"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Zma&zať všetko"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Z&akázať všetko"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "Zap&núť všetky"

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Povolené"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Výraz"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Vlastnosti"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Zoznam Pozorovaní"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Slovo na kurzore aktuálneho editora"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Pracovný adresár pre budovanie"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Pracovný adresár pre spustenie"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Chyba zápisu"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Chyba zápisu: %s%sSúbor: %s%s%s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "XML Chyba"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Súbory XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Chyba parsera XML v súbore %s%sChyba: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Nemôžete vybudovať Lazarus počas ladenia alebo prekladu."

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor kódu"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Pridať jednotku balíčka do sekcie uses"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Pridať obrátene"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Automaticky zvyšovať číslo vybudovania"

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Dostupné skenery"

#: lazarusidestrconsts.rsbuild
#, fuzzy
#| msgid "Build:"
msgid "&Build:"
msgstr "Vybudovať:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Množina znakov:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "zatvoriť túto stránku"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Podmienené definície"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Vytvoriť novú definíciu"

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr ""

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Zapnúť i18n"

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
#, fuzzy
#| msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "zadajte jednu alebo viac frází, ktoré chcete hľadať alebo filtrovať v zozname, oddeľte medzerami alebo čiarkami"

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "Filtruje zoznam pomocou aktuálneho výrazu filter"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Dátový súbor formulára  (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "Prejsť na ďalšiu položku v zozname hľadaní"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Voľby i18n"

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Do preloženého programu zahrnúť informácie o verzii"

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Vlastná pozícia"

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Predvolené"

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Dokované"

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Obnoviť geometriu okien"

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Obnoviť veľkosť okna"

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Použi nastavenia správcu okien"

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Kláves"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Africky"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabsky"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automaticky (alebo anglický)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Katalánsky"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Čínsky"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr ""

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandsky"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Anglicky"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finsky"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francúzsky"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Nemecky"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebrejsky"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonézsky"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Taliansky"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonsky"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litovsky"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Voľby jazyka"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Poľsky"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Portugalsky"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Ruský"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Výber jazyka:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovensky"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Španielsky"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turecky"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrajinsky"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr "OK"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Ostatné informácie"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Výstupný adresár pre .po:"

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Odstrániť"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "Vymazať filter"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Skenery"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Vybrať zdedenú položku"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Začať nové hľadanie"

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Hodnota"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Číslovanie verzií"

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Kláves \"%s\" už je pripojený k \"%s\"."

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternatívny kláves (alebo kombinácia dvoch)"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Príkazu menu Help"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Príkazy Command"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Príkazy CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Príkazy presunu kurzora"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Príkazy úpravy textu"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Príkazy menu Prostredie"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Príkazy menu Súbor"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Príkazy značkovania textu"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Príkazy menu Balíček"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Príkazy menu Projekt"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Príkazy menu Spustiť"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Príkazy hľadania a nahradzovania textu"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Príkazy výberu textu"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Príkazy zdrojových poznámok"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Príkazy menu Nástroje"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Príkazy menu Zobraziť"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Príkaz:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr "    príkaz1 \""

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr "    príkaz2 \""

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt"

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " v konflikte s"

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "zrušiť budovanie"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Pridať bod skoku"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "pridať pozorovanie"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Šablóny dokončovania kódu"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Zväčšiť odsadenie bloku"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Zmenšiť odsadenie bloku"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "vybudovať program/projekt"

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "vybudovať všetky súbory programu/projektu"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "vybudovať súbor"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Vybudovať Lazarus"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Znak"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Zmazať celý text"

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Editor definícií CodeTools"

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Voľby CodeTools"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Stĺpcový režim výberu"

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "voľby prekladača"

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Dokončovanie kódu"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "konfiguračný súbor budovania"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Kopírovať výber do schránky"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Vlastný nástroj %d"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Vystrihnúť výber do schránky"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Zmazať po začiatok riadka"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Zmazať znak na kurzore"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Zmazať do konca riadka"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Zmazať posledná znak"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Zmazať po začiatok slova"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Zmazať aktuálny riadok"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Zmazať do konca slova"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Rozdiely"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Posunúť kurzor na úplný koniec"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Posunúť kurzor o na úplný začiatok"

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "vyskúšať/zmeniť"

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Oddeliť procedúru"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Externý nástroj %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Nastavenie externých nástrojov"

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Nájsť text"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Nájsť druhý koniec bloku"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Nájsť začiatok bloku"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Nájsť deklaráciu"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Nájsť odkazy na identifikátor"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Nájsť v súboroch"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Nájsť ďalšie"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Nájsť ďalší výskyt slova"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr ""

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Nájsť predchádzajúci"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Nájsť predchádzajúci výskyt slova"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Nájsť definíciu procedúry"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Nájsť metódu procedúry"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Choď na editor %d "

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Choď na direktívu include aktuálneho include súboru"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Choď na riadok číslo"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Choď na značku %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Choď na XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Odhadni zle umiestnený $IFDEF"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Vložiť položku ChangeLog"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Vložiť z mapy znakov"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Vložiť kľúčové slovo CVS Author"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Vložiť kľúčové slovo CVS  Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Vložiť kľúčové slovo CVS Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Vložiť kľúčové slovo CVS ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Vložiť kľúčové slovo CVS Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Vložiť kľúčové slovo CVS Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Vložiť kľúčové slovo CVS Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Vložiť kľúčové slovo CVS Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Vložiť aktuálny dátum a čas"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Vložiť vyhlásenie GPL"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Vložiť GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Vložiť LGPL vyhlásenie"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zalomiť·riadok·a·ponechať kurzor"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Režim vkladania"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Vložiť upravené LGPL vyhlásenie"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Vložiť aktuálne používateľské meno"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "skontrolovať"

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Otočiť priradenie"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zalomiť riadok a presunúť kurzor"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Posunúť kurzor na koniec riadka"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Riadkový režim výberu"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Posunúť kurzor na začiatok riadka"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Vytvoriť ResourceString"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Choď na vyhovujúcu zátvorku"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Okno editora vľavo"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Posunúť editor úplne vľavo"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Okno editora vpravo"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Posunúť editor úplne vpraco"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Nasledujúca záložka"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Choď na nasledujúci editor"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normálny režim výberu"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Otvoriť súbor na kurzore"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Režim prepisovania"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Posunúť kurzor na spodok strany"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Posunúť kurzor o stranu dole"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Posunúť kurzor o stranu vľavo"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Posunúť kurzor o stranu vpravo"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Posunúť kurzor na začiatok strany"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Posunúť kurzor o jednu stranu hore"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Vložiť zo schránky na aktuálnu pozíciu"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "prerušiť program"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Predchádzajúca záložka"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Choď na predchádzajúci editor"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "rýchly preklad, nelinkuje"

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr ""

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "odstrániť bod prerušenia"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Odstrániť prázdne metódy"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr ""

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Premenovať identifikátor"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Nahradiť text"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr ""

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reštartovať debuger"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "spustiť program"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "spustiť súbor"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parametre spustenia"

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Uložiť"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolovať o riadok dole"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolovať o znak vľavo"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolovať o znak vpravo"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolovať  o riadok hore"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Vybrať dole"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Vybrať všetky"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Konvertuj tabulátory na medzery vo výbere"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Vybrať po úplný koniec"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Vybrať po úplný začiatok"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr ""

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr ""

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Vybrať do konca riadka"

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Vybrať po začiatok riadka"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Vybrať do konca strany"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Vybrať stranu dole"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Vybrať stranu vľavo"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "vybrať stranu vpravo"

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Vybrať vrch strany"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Vybrať stranu hore"

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr ""

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Vybrať hore"

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Vybrať slovo vľavo"

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Vybrať slovo vpravo"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastaviť voľnú záložku"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Nastav značku %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Zobraziť abstraktné metódy"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Zobraziť kontext kódu"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "zastaviť program"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Kontrola syntaxe"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Zobraziť body prerušenia"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Zobraziť Zásobník volaní"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Zobraziť Prehliadač kódu"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Zobraziť Prieskumník kódu"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Zobraziť Paletu komponentov"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Zobraziť výstup debugera"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Prepnúť medzi formulárom a jednotkou"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Zobraziť Editor dokumentácie"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Zobraziť tlačítka IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Zobraziť lokálne premenné"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Zobraziť Správy"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Režim prepínania"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Zobraziť Inšpektor objektov"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Zobraziť obmedzenia prehliadača"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Zobraziť Výsledky hľadania"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Zobraziť editor zdrojového kódu"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Zobraziť Pozorovania"

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr ""

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "neznámy príkaz editora"

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Najprv používateľské"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Zobraziť Editor ukotvenia"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Zobraziť komponenty"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Zobraziť formuláre"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Zobraziť závislosti jednotiek"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Zobraziť info o jednotke"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Zobraziť jednotky"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Dokončovanie slov"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Posunúť kurzor o slovo vľavo"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Posunúť kurzor o slovo vpravo"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Uparviť klávesy príkazu"

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Upraviť klávesy"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Zachytiť klávesu"

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Zachytiť druhú klávesu"

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Kláves (alebo kombinácia dvoch)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Prosím stlačte klávesu ..."

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr ""

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Súbor je len na čítanie"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Súbor \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" nie je zapisovateľný."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "&Pridať pozorovanie v mieste kurzora"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Záložka"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Zatvoriť stránku"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Dokončovanie kódu"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopírovať"

#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Kopírovať meno súboru"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to new Window"
msgstr ""

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr ""

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Vystrihnúť"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Ladiť"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Vlastnosti editora"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Uzavrieť výber"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kódovanie"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr ""

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Oddeliť procedúru"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Nájsť deklaráciu"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Nájsť odkazy na identifikátor"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Choď na záložku"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Zvýrazňovač"

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr ""

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Otočiť priradenie"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr ""

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr ""

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr ""

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr ""

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr ""

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr ""

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr ""

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Choď na ďalšiu záložku"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Zmenené"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Otvoriť súbor pod kurzorom"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Vložiť"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Choď na predchádzajúcu záložku"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Prejsť na procedúru"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Len na čítanie"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Premenovať identifikátor"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Spustiť po kurzor"

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Nastaviť záložku"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Nastaviť voľnú záložku"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zobraziť čísla riadkov"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Informácie o jednotke"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr ""

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Zobraziť Zásobník volaní"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Zatiaľ neimplementované"

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Vravel som. Zatiaľ neimplementované"

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Ak nám chcete pomôcť implementovať túto vlastnosť, pošlite email na lazarus@miraclec.com"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Len na čítanie"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informácie o verzii"