lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.ru.po

msgid ""
msgstr ""
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Project-Id-Version: lazaruside\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2011-01-05 16:30+0300\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Использовать готовую схему"

#: lazarusidestrconsts.dlfmouseresetall
#| msgid "Set all settings"
msgid "Reset all settings"
msgstr "Сбросить все параметры"

#: lazarusidestrconsts.dlfmouseresetgutter
#| msgid "Set all gutter settings"
msgid "Reset all gutter settings"
msgstr "Сбросить все параметры поля (лев)"

#: lazarusidestrconsts.dlfmouseresettext
#| msgid "Set all text settings"
msgid "Reset all text settings"
msgstr "Сбросить все параметры текста"

#: lazarusidestrconsts.dlfmousesimplediff
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changes"
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Эта страница не отражает текущие значения расширенных параметров. Используйте данную страницу для сброса любых их изменений"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Общие"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr "Стандартное, все действия - при нажимании кнопки мыши"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr "Расширенное, действия - при отпускании кнопки мыши. Выделение - при нажимании и перемещении"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Поле (лев)"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Перемещать курсор по правой кнопке мыши"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "Режим выделения столбца по кнопке Alt"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr "По Ctrl - левой кнопке мыши"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr "переходить к реализации"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr "переходить к реализации/другому концу блока"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr "ничего не делать"

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr "Выделять строку двойным щелчком"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr "Копировать/вставлять перетаскиванием"

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr "переходить к реализации"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "По средней кнопке мыши"

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr "ничего не делать"

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr "вставлять выделенное"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Имеются несохранённые изменения. Использование этой страницы сбросит изменения на странице расширенных параметров"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Нет >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Только чтение"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Только первая буква заглавная"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Добавлять оператор присваивания :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Подсветка скобок"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Дерево сворачиваний кода"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Текст по умолчанию"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Отключённая точка останова"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Включённая точка останова"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Строка с ошибкой"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Точка исполнения"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
#| msgid "Folded code"
msgid "Folded code marker"
msgstr "Знак свёрнутого кода"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Глобальные"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Поле (лев)"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Строка"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Синхронное редактирование"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Редактирование шаблона"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Линия отделения поля (лев)"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
#| msgid "Incremental search others"
msgid "Incremental others"
msgstr "Остальные совпадения при инкрементном поиске"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Подсветка текущего слова"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
#| msgid "Incremental search match"
msgid "Incremental search"
msgstr "Текущее совпадение при инкрементном поиске"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Неработоспособная точка останова"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
#| msgid "Line highlight"
msgid "Current line highlight"
msgstr "Подсветка текущей строки"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Номер строки"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Изменённая строка"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Ссылка при наведении мыши"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
#| msgid "SyncronEdit Range"
msgid "Selected Area"
msgstr "Выделенная область"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
#| msgid "SyncronEdit Current Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Активное поле"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
#| msgid "SyncronEdit Other Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Другие поля"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
#| msgid "SyncronEdit Syncron Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Синхронизируемые поля"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
#| msgid "TemplateEdit Current"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Активное поле"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
#| msgid "TemplateEdit Cells"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Другие поля"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
#| msgid "TemplateEdit Sync"
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Синхронизируемые поля"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Выделение текста"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Неизвестная точка останова"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Операторные скобки"

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Дополнительные пути к исходным кодам для всех проектов (.pp; .pas)"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Добавлять точку с запятой"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Выровнять верхнюю строку по комментарию"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Все файлы"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "По алфавиту"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Всегда видимый курсор"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Неясное действие с файлом:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Предупредить при компиляции"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Параметры приложения"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "По умолчанию"

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Включить код Assert"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автосоздаваемые формы:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "При создании новых форм добавить их к автосоздаваемым"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Автоматически удалить файл"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Скрывать курсор мыши во время набора текста"

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "Автоматический отступ"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr "(Настроить)"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Автоматически удалять пустые методы"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Переименовать в нижний регистр"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Автосохранение"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Доступные формы:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Фон"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(нет подкаталога)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "То же имя (в подкаталоге)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "После методов"

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr "Выделение:"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Отступ блока"

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr "Метод создания отступов"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Пробел/ТАБ как на строке ранее"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "По положению"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Пробелы"

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Совместимость с TP/BP 7.0"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Подсветка скобок"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "Парные скобки"

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "Файл сообщений компилятора Free Pascal (*.msg)|*.msg|Все файлы (*.*)|*.*"

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Применить"

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "&Учитывать регистр"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Проверка параметров компилятора"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Результаты"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Тест"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Тест: проверка компилятора ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Тест: проверка конфигурации компилятора ..."

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Тест: проверка конфигурационных файлов компилятора ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Тест: проверка даты компилятора ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Тест: компиляция пустого файла ..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Тест: поиск отсутствующих ppu компилятора ..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Тест: проверка наличия файлов исходного кода в путях поиска ppu ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Тест: компиляция пустого файла"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "В порядке классов"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "В конце"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "нижний регистр"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Предпросмотр (max длина = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префикс READ"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Префикс STORED"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНИЙ РЕГИСТР"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префикс переменной"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префикс WRITE"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Курсор в центре"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Автопереименование в нижний регистр в диалоге 'Сохранить как'"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Проверить целостность"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Проверять пакеты при создании формы"

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Выберите файл шаблонов кода (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Политика вставки частей класса"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Показывать кнопки закрытия вкладок"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Цветовая схема"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Макросы в стиле C (глобально)"

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Использовать строки Ansi"

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "Как-есть"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Стиль ассемблера:"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Сообщения"

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Проверки"

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Компиляция"

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr "Режимы сборки"

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Операторы в стиле C (*=, +=, /= и -=)"

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "Создать элемент-потомок"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Создать Makefile"

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "Создать элемент выше"

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "Создать элемент ниже"

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Генерировать отладочную информацию для DBX (замедляет сборку)"

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Отладка:"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Дополнения к путям отладчика (нет):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Создание кода"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Сворачивать и скрывать"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Сворачивать"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Скрывать"

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Мышь"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Обратить порядок элементов во всплывающем меню"

#: lazarusidestrconsts.dlgcodegeneration
#| msgid "Code"
msgid "Code generation"
msgstr "Генерация кода"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Параметры CodeTools"

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Быстрый код"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Генерировать отладочную информацию для GDB (замедляет сборку)"

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Кодогенерация"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Использовать модуль Heaptrc"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Включаемые файлы (-Fi):"

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Унаследованные"

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Хранить отдельные переменные в регистрах"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Библиотеки (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Компоновка"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Загрузка/сохранение"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Цвет"

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Экспорт"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Изменить цвет)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Исходный"

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Параметры командной строки"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметры командной строки (без имени приложения)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr "Переместить вниз"

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr "Переместить на уровень вниз"

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr "Переместить уровень вверх"

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr "Переместить вверх"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr "Сообщения компилятора"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "Языковой файл сообщений компилятора"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Параметры компилятора"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершать свойства"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Конфигурационные файлы:"

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Нормальный код"

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Параметры"

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Другие"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Переполнения"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Обработка"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Копировать/вставлять со свёрнутостью"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Копировать слово при пустом копировании"

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Диапазона"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Показывать ошибки"

#: lazarusidestrconsts.dlgcoshowoptions
#| msgid "Show Options"
msgid "&Show Options"
msgstr "&Показать параметры"

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Меньший код"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Умная компоновка"

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Другие исходные коды (файлы .pp/.pas, нужны только IDE, не компилятору)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Стека"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Вырезать символы из исполнимого файла"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Стиль модулей"

#: lazarusidestrconsts.dlgcouseasdefault
#| msgid "Use these settings as default for new projects"
msgid "Use these compiler options as default for new projects"
msgstr "Использовать текущие параметры по умолчанию для новых проектов"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Генерировать код для Valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Подробность вывода"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE в стиле C++"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "По Ctrl-средней кнопке мыши на вкладке закрывать остальные"

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Курсор вне конца строки"

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr "Параметры курсора:"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Курсор пропускает выделенное"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Курсор пропускает ТАБы"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Расширение пользователя (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Редактор путей"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип отладчика и путь"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Шрифт редактора по умолчанию"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Значение по умолчанию"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Расширения Delphi 2"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Удалить шаблон "

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Совместимость с Delphi"

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Рабочий стол"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Кнопок - "

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Файлы рабочего стола"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Подсказки"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Меню - "

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Разные параметры"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Направление"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Каталог не существует"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Отключить сглаживание"

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Использовать цвет правой границы"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Уровень отображения разделителя"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Цвет вложенной линии"

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr "Отображать разделитель"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Цвет линии"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Процедура/функция"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Класс/объект/запись"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Класс/объект/запись (локальные)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Разделы модуля"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Выражение Uses"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Секции Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Секции Var/Type (локальные)"

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Добавить..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Назад"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Жирный"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Подкаталог"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Шаблоны кода"

#: lazarusidestrconsts.dlgedcolor
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Цвет"

#: lazarusidestrconsts.dlgedcompleteblocks
#| msgid "Complete blocks"
msgid "Add close statement for pascal blocks"
msgstr "Добавлять к блокам Паскаля завершающий оператор"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Расширение пользователя"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Задержка"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(задержка %s сек)"

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Отображение"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Редактировать..."

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Файлы редактора"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Завершить идентификатор"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Обратить"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
#| msgid "Ignore Locks, longest unused editor"
msgid "Ignore Locks, use longest unused editor"
msgstr "Игнорировать фиксацию для не использовавшегося наибольшее время редактора"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Игнорировать фиксацию для текущего редактора"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Игнорировать фиксацию для редактора в текущем окне"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Зафиксированный, если текст в области просмотра"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Незафиксированный"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Незафиксированный, если текст в центре области просмотра"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Новая вкладка в существующем или новом окне"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Новая вкладка в новом окне"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Новая вкладка в существующем окне"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
#| msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\"This option will always succeed, further options are never tested."
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Использование этого критерия приводит к выбору не использовавшегося наибольшее время редактора для файла, даже если он зафиксирован и/или ему требуется прокрутка. При этом не учитывается порядок перевода фокуса в окна, даже если он переводился по тому же набору критериев. Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Использование этого критерия приводит к проверке наличия целевого файла в текущем активном редакторе. Если файл открыт, будет использоваться текущий редактор, даже если он зафиксирован и/или ему требуется прокрутка."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
#| msgid "This option will check if there is an editorfor the target file in the current windowand if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Использование этого критерия приводит к проверке наличия редактора для целевого файла в текущем окне. Найденный редактор будет использован, даже если он зафиксирован и/или ему требуется прокрутка."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
#| msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point(target jump point is already in visible screen area)"
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Использование этого критерия приводит к выбору зафиксированного (и только зафиксированного) редактора, которому не требуется прокрутка для отображения целевой точки перехода (она уже находится в области просмотра)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
#| msgid "This option will use any not locked Editor"
msgid "This option will use any not locked Editor."
msgstr "Использование этого критерия приводит к выбору любого незафиксированного редактора."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
#| msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point(target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)"
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Использование этого критерия приводит к выбору незафиксированного редактора, которому не требуется прокрутка для отображения целевой точки перехода (она уже находится в центре области просмотра, то есть исключая 2-5 строк сверху и снизу)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
#| msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested"
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Использование этого критерия приводит к открытию новой вкладки в существующем или новом окне, если не найдено незафиксированного редактора. Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
#| msgid "If no unlocked tab is found, then this option will open a new Tab in a new  Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Если не найдено незафиксированного редактора, использование этого критерия приводит к открытию новой вкладки в новом окне (даже если для этого могут быть использованы существующие окна). Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#| msgid "This option will open a new Tab in an existing (and only in an existing) Window, if no unlocked tab is found. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Если не найдено незафиксированного редактора, использование этого критерия приводит к открытию новой вкладки в существующем (и только в существующем) окне. Вкладка открывается только при наличии окна, ещё не имеющего редактора для целевого файла."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Курсив"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Шрифт редактора"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Высота шрифта"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Параметры редактора"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Глобальная схема"

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Разное"

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Ошибок в раскладке не найдено."

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Выкл."

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Вкл."

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Подчёркнутый"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Атрибуты элементов"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "End переводит к концу текста в строке"

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "С начала &фрагмента"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Спросить"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Внимание, файлы проекта - все файлы в его каталоге"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Резервирование"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Цвета"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Файлы"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Сетка"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Язык"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Линии позиционирования"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Разное"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Прочие файлы"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Проект"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Переводить фокус в окно сообщений после компиляции"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Дополнительный межсимвольный интервал"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Межстрочный интервал"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Использовать внешний файл отладочных символов GDB"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Расширения файлов"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Поиск текста под курсором"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Последовательность"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Секция последовательности"

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Файл"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Комментарий"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Элемент"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Элемент"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Список <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Объект (унаследованный, вложенный)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Секции Var/Type (локальные)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Комментарий (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Секция Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (вложенная)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Комментарий { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Класс/объект"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "Секции public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Вложенный комментарий"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (процедура)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Программа"

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "Запись"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Комментарий //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Секция модуля"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Используемые модули"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Секции Var/Type (глобальные)"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "Секция CDATA"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Комментарий"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "Секция DOCTYPE"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Элемент"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Команда обработки"

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Цвет текста"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Политика вставки процедур"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Сохранять порядок процедур"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Путь компилятора (%s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Каталог исходного кода FPC"

#: lazarusidestrconsts.dlgframecolor
#| msgid "Frame color"
msgid "Text-mark"
msgstr "Отметка"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "От &курсора"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Параметры"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr "Генерировать отладочную информацию в формате DWARF"

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Принять позицию"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "Во всём т&ексте"

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Совместимость с GPC (GNU Pascal Compiler)"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Генерировать код для gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Узел захвата"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Сетка"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Размер X сетки"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Шаг сетки по горизонтали"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Размер Y сетки"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Вертикальный шаг сетки"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "CodeTools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Отладчик"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Редактор"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Окружение"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Справка"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Групповая отмена"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Показывать линии позиционирования"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Поле (лев)"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Свёрнутый"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Цвет поля (лев)"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Цвет границы поля (лев)"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Положение отделителя поля (лев)"

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Ширина поля (лев)"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на половину страницы"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Размер кучи"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Высота:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Скрывать окна IDE при запуске"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Скрывать значки в окне сообщений"

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Скрывать заголовок одиночной вкладки"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Выделение"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Шрифт выделенного"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Слева от курсора"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Справа от курсора"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Подсказки 'Parameter \"Sender\" not used'"

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Подсказки о неиспользуемых модулях"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home переводит к началу текста в строке"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Главное приложение"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Завершение идентификаторов"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Политика идентификаторов"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Параметры IDE"

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Пропустить"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включить системные переменные"

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Выровнять код по"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr "Параметры отступа/табуляции:"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор должен называться 'init' (деструктор - 'done')"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Вставлять пробелы после"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставлять пробелы перед"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Интервал в сек"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Переход (например, по методу)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Сохранять позицию курсора по оси X"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Привязки клавиш"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Ошибки привязок клавиш"

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Схема раскладки клавиш"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Политика ключевых слов"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Разрешить LABEL и GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Язык"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Последними (т.е. в конце исходного кода)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Каталог Lazarus (общий для всех проектов)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Слева:"

#: lazarusidestrconsts.dlglefttopclr
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "Левая и верхняя линии позиционирования"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Уровень 1 (быстро и дружественно к отладчику)"

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Уровень 2 (уровень 1 + быстрые оптимизации)"

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Уровень 3 (уровень 2 + медленные оптимизации)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Уровень 0 (без особой оптимизации)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Разрыв строк"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Стиль компоновки"

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Умная компоновка"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Выдавать номера строк в ошибках времени исполнения"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Загрузить рабочий стол из файла"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Главное меню"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Показать формы проекта"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Показать фреймы проекта"

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Путь к Make"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Границы"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Маркер"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr "Подсветка текущего слова под курсором"

#: lazarusidestrconsts.dlgmarkupwordfulllen
#| msgid "Ignore bounds for words longer than"
msgid "Match word boundaries for words up to this length:"
msgstr "Искать границы для слов не длиннее "

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr "Игнорировать зарезервированные слова"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr "Отключить подсветку текущего слова"

#: lazarusidestrconsts.dlgmarkupwordtrim
#| msgid "Trim Spaces"
msgid "Trim Spaces (when highlighting current selection)"
msgstr "Обрезать пробелы (при подсветке текущего выделения)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимум счетчика"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "max длина строки:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Максимальное количество недавних файлов"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Максимальное количество недавних проектов"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Политика вставки методов"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Смешивать методы и свойства"

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Кнопка"

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Левая"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Средняя"

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Правая"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "Свернуть все (некоторые свёрнуты)"

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "Свернуть один (некоторые свёрнуты)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "Развернуть все (некоторые свёрнуты)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "Развернуть один (некоторые свёрнуты)"

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Включить"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "Свернуть все (все развёрнуты)"

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "Свернуть один (все развёрнуты)"

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Параметр 1"

#: lazarusidestrconsts.dlgmousefoldgroup2
#| msgid "setting 2"
msgid "Setting 2"
msgstr "Параметр 2"

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr "Параметры мыши:"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Одинарный"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr "Двойной"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr "Тройной"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr "Четверной"

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Добавить"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Любой"

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Экспорт"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr "Дополнительная 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr "Дополнительная 2"

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "Импорт"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Левая"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Средняя"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Сброс"

#: lazarusidestrconsts.dlgmouseoptbtnok
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "ОК"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Правая"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Изменить"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Область захвата"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Перемещать курсор (дополнительно)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "При отпускании"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Действие"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Щелчок"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Редактор действия"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Дублирующийся элемент"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Этот элемент противоречит уже существующему"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Кнопка"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Курсор"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Контекст"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Щелчок"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Действие"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Фаза щелчка"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Параметр"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Порядок"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Приоритет"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Мышь"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Расширенные"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Команда IDE"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "н"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Д"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Д"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Поле (лев)"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Дерево сворачиваний"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Свёрнутые [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Развёрнутые [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Номера строк"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Текст"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Выделение"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Другие действия по той же кнопке мыши"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr "Эти действия могут быть выполнены в зависимости от нажатия клавиш-модификаторов и других установленных для них параметров"

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Фильтровать по модификаторам"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Приоритет"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Сообщения"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Множественное выделение"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
#| msgid "Find jump target editor:"
msgid "Find editor for jump targets:"
msgstr "Выбор редактора для перехода:"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Порядок использования редакторов, отвечающих одинаковым критериям"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Последний выбранный редактор для данного файла"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Редактор (для файла) в последнем выбранном окне"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Список критериев выбора редактора по приоритету:"

#: lazarusidestrconsts.dlgmultiwinoptions
#| msgid "Multi Window"
msgid "Pages and Windows"
msgstr "Вкладки и окна"

#: lazarusidestrconsts.dlgmultiwintabgroup
#| msgid "Tabs:"
msgid "Notebook Tabs:"
msgstr "Вкладки редакторов:"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Именование"

#: lazarusidestrconsts.dlgnoautomaticrenaming
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Не переименовывать автоматически"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Не подсвечивать"

#: lazarusidestrconsts.dlgnotebooktabpos
#| msgid "Positoon for source-notebook tabs"
msgid "Source notebook tabs position"
msgstr "Положение заголовков вкладок редактора"

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "Снизу"

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Слева"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Справа"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "Сверху"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Не разрывать строку после:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Не разрывать строку перед:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Инспектор объектов"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Высота элемента"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Разное"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Параметры"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Быстрая настройка"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Использовать параметры по умолчанию Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Использовать параметры по умолчанию Lazarus"

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Оптимизации"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Другие модули (-Fu) (разделитель - точка с запятой):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr "Заменять выделение"

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr "Диаграмма пакетов"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Подсказки палитры компонентов"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Стандартное расширение Паскаля"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Подсвечивать операторы управления как ключевые слова"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr "Расширенные параметры ключевых слов Паскаля"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Передавать параметры компоновщику (отделять пробелами)"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr "Подсветка ключевого слова String"

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "По умолчанию"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Только \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr "Постоянное выделение"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Постоянный курсор"

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Группа пакетов"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Приложение"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Очистить значок"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Создать Application Bundle"

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr "Приложение с поддержкой различных DPI (для Vista+)"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Формы"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Значок:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(размер: %d:%d, бит/пиксель: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(нет)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Загрузить значок"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Разное"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Параметры вывода"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Сохранить значок"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Сеанс работы"

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Имя исполнимого файла:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Заголовок:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Использовать Application Bundle для запуска и отладки (только для Darwin)"

#: lazarusidestrconsts.dlgpousemanifest
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Использовать manifest-файл для включения поддержки тем (только Windows)"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Параметры проекта"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Параметры проекта: %s"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Файлы проекта"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "Спрашивать при &замене"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Завершение свойств"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Имя свойства"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Автоматически закрывать диалог компиляции"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Открывать последний проект при запуске"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Показывать зазор у границ"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Показывать диалог компиляции"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Показывать сетку"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Выравнивать по сетке"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Ссылка"

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Регулярные выражения"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Заменить &Все"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Заменить на"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Отчёт"

#: lazarusidestrconsts.dlgrightbottomclr
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Правая и нижняя линии позиционирования"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Выделять правым щелчком мыши"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Правая граница"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Рабочий каталог"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Выделять внуков"

#: lazarusidestrconsts.dlgruberbandcreationcolor
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Прямоугольник создания"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Прямоугольник выделения"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, например, 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Окружение"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Локальные"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Системные переменные"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Использовать дисплей"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Пользовательские замены"

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Переменная"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Параметры запуска"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Сохранить рабочий стол в файл"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Сохранённая строка"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Сохранять сведения о закрываемых файлах"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Сохранять сведения только о файлах проекта"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Где"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Прокручивать на строку меньше"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr "Параметры прокрутки:"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Показывать подсказку при прокрутке"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокручивать за конец файла"

#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "Прокручивать за конец строки"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Каталог поиска \"%s\" не найден."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Поиск прерван пользователем."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Поиск..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Пути"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "В вы&деленном"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Установить все элементы по умолчанию"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Установить элемент по умолчанию"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Переменная свойства"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Показывать названия компонентов"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показывать компилируемые процедуры"

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Показать параметры компилятора"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Показывать номера строк"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Показывать условия"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показывать отладочную информацию"

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Показывать определённые макросы"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Показывать подсказки редактора"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Показывать всё"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Показывать информацию об exe (только Win32)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показывать общие сведения"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Всплывающие подсказки поля (лев)"

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Показывать подсказки"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Показывать номера строк"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Показывать заметки"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Ничего не показывать (только ошибки)"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Все процедуры при ошибках"

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Показывать подсказку при прокрутке"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Показать сводку"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Показывать опробованные файлы"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Показывать используемые файлы"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Показывать предупреждения"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Показывать одну кнопку в панели задач"

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr "Пропускать предваряющие объявления"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Умные ТАБы"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ сзади (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Счетчик (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ спереди (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Выравнивать по линиям позиционирования"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Пробел"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Подсказки командных кнопок (открыть, сохранить и т.д.)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Редактор исходного кода"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Начинать"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Ключевое слово Static в объектах"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Останов после числа ошибок"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Подсвойства"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Параметры синтаксиса"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ меняет отступ блоков"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Показывать номера вкладок"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Преобразование ТАБ в пробелы"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Ширина ТАБа"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Целевое семейство процессоров"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Операционная система"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Целевая платформа"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Целевой процессор"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Каталог для сборки пробных проектов"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Найти текст"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Каталог \""

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "сек"

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Отображать вычисленные значения в подсказках"

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Отображать подсказки для идентификаторов"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Верх:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Имя файла шаблона"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr "Метод обрезки пробелов"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "При курсоре или правке"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "При правке строки"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "При покидании строки"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Только позиция курсора"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрезать хвостовые пробелы"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Ненадёжные оптимизации"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Список отмен после сохранения"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr "Параметры отмены:"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Лимит отмен"

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "Открыть"

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Зависимости модуля"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Обновить"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Каталог вывода модулей (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Несохранённая строка"

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Сворачивание кода"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr "Использовать дополнительный конфигурационный файл компилятора"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr "Отображение разделителя"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Использовать стандартный конфигурационный файл компилятора (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Использовать приложение для запуска"

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "Использовать файл сообщений"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Не удалось загрузить файл пользовательской схемы %s"

#: lazarusidestrconsts.dlguseschemedefaults
#| msgid "Use global scheme settings"
msgid "Use (and edit) global scheme settings"
msgstr "Использовать (и менять) глобальную схему"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Использовать локальную схему"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Подсветка синтаксиса"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Учитывать историю вкладок при их закрытии"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробность вывода при компиляции"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Видимое поле (лев)"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Правая видимая граница"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&Только целые слова"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ширина:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Графическое приложение Win32"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Окно"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Позиции окна"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Предпросмотр"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Выводить логотип FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Множественный выбор компонентов должен быть на одной форме"

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Выравнивание"

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Удалить выбранное"

#: lazarusidestrconsts.fdmmirrorhorizontal
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Отразить по горизонтали"

#: lazarusidestrconsts.fdmmirrorvertical
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Отразить по вертикали"

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Порядок"

#: lazarusidestrconsts.fdmorderbackone
#| msgid "Back one"
msgid "Back One"
msgstr "На один назад"

#: lazarusidestrconsts.fdmorderforwardone
#| msgid "Forward one"
msgid "Forward One"
msgstr "На один вперёд"

#: lazarusidestrconsts.fdmordermovetoback
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Поместить сзади"

#: lazarusidestrconsts.fdmordermovetofront
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Поместить cпереди"

#: lazarusidestrconsts.fdmsaveformasxml
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Сохранить форму в виде XML"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Масштаб"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Выделить все"

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Размер"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр: Выровнять по сетке"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр: Выровнять по линиям позиционирования"

#: lazarusidestrconsts.fdmtaborder
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Порядок перехода..."

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-порядок"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "С обеих сторон"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = не отображать, 1 = отображать только для верхнего уровня, 2 = отображать для первых двух уровней и т.д."

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Добавить файл"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Добавить файлы"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Добавить файлы к пакету"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Добавить LFM, LRS файлы, если есть"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Добавить к пакету"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Добавить модуль"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Неясный тип предка"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Дублирующееся имя класса"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Дублирующееся имя модуля"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Тип предка"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля должен иметь расширение .pp или .pas"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Нарушенные зависимости"

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<выберите существующий файл>"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Имя класса уже существует"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Создать новый файл"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Зависимость"

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sСуществующий файл: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл уже существует"

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Файл %s%s%s уже есть в проекте."

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Файл уже в пакете"

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Файл используется"

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Имя файла:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Имя файла"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл не является модулем"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неверный тип предка"

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Порочный цикл"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неверное имя класса"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неверный файл"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неверное имя файла"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неверное имя модуля"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s не является корректным именем модуля."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Новое имя класса:"

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Новый компонент"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Новый файл"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Не найдено пакета для зависимости %s%s%s.%sВыберите существующий пакет."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Имя страницы слишком длинное"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Страница палитры:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Модули Паскаля должны иметь расширение .pp или .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Диалог сохранения файла"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Сократить или развернуть имя файла"

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Показать все"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Переключить пути"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Название типа предка %s%s%s совпадает с%sмодулем %s%s%s."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Тип предка %s%s%s не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Имя класса %s%s%s и его предка %s%s%s совпадают."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Имя класса %s%s%s уже имеется в%sПакете %s%sФайл: %s%s%s"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Имя класса %s%s%s совпадает с %s именем модуля %s%s%s."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Имя класса %s%s%s не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Файл %s%s%s уже имеется в пакете."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл %s%s%s уже принадлежит текущему проекту.%sИметь общие файлы в проектах и пакетах запрещается."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Имя файла %s%s%s не определено, так как пакет ещё не имеет каталога по умолчанию.%sПожалуйста, укажите имя файла с полным путём."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Минимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Пакет уже имеет зависимость от пакета %s%s%s"

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Имя пакета %s%s%s слишком длинное (надо до 100 симв.)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Имя модуля %s%s%s уже занято в этом пакете:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Имя модуля %s%s%s уже занято в этом пакете."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Имя модуля %s%s%s%sи имя файла %s%s%s различаются."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Имя модуля %s%s%s не соответствует имени файла"

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Имя модуля совпадает с зарегистрированным компонентом.%sЭто может привести к странным сообщениям об ошибках."

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Имя файла модуля:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Имя модуля:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Модуль с таким именем уже существует"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Имя модуля недопустимо"

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Искать в модуле имя и процедуру Register"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Отбросить изменения?"

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Во время создания Application Bundle произошла ошибка: "

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Прервать все"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Прервать всю загрузку"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Прервать загрузку проекта"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Прервать всю загрузку"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Документация:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Об IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "О проекте Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Лицензия: GPL/LGPL. Обратитесь к исходному коду Lazarus и Free Pascal за подробностями.%sLazarus - это IDE для создания графических и консольных приложений при помощи компилятора Free Pascal. Free Pascal - это компилятор языков Pascal и Object Pascal, работающий под Windows, Linux, Mac OS X, FreeBSD, и другими ОС.%sLazarus - это недостающий элемент, который позволит вам разрабатывать программы для всех вышеперечисленных платформ в Delphi-подобном окружении. Эта IDE является инструментом RAD, включающим в себя дизайнер форм.%sТак как проект Lazarus растёт, он нуждается в большем количестве разработчиков."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Невозможно найти список участников"

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Официальный сайт:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s не может содержать компоненты TControl.%sВ него можно помещать только невизуальные компоненты."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Благодарности"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Действие:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Действия:"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Активировать синтаксис регулярных выражений для текста и замены (почти как в perl)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Активен"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Текущий фильтр"

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "Добавить каталог"

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Добавить файлы каталога"

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Дополнительные параметры компилятора, унаследованные от пакетов"

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Добавить новый режим сборки с параметрами режима \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Добавить новый макрос"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Добавить новый набор"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Добавить зависимость от пакета?"

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Добавить пакет %s к проекту?"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Добавить пакет к проекту"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Добавлять скобки для параметров"

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Добавить к путям поиска включаемых файлов?"

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Добавить %s к проекту?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Добавить к путям поиска модулей?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Добавить модуль Interfaces"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Добавить модуль (не рекомендуется)"

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "Добавить значение:"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Добавить значение в макрос %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Добавить файл к пакету"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Пакет назначения"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Тип файла"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Имеет процедуру Register"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неверный пакет"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Неверный идентификатор пакета: %s%s%s"

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Виртуальный модуль (исходный код не в пакете)"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакет только для чтения"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Пакет %s%s%s не найден"

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Показать все"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sуже в пакете %s."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Пакет %s только для чтения."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Имя модуля: "

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Файл %s%s%s уже существует.%s Заменить?"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Выравнивание"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Все блоки выглядят нормально."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Все файлы"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Все унаследованные параметры"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Разрешить вызовы функций"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Разрешить поиск для нескольких строк"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Все ваши изменения в %s%s%s%sбудут утеряны и файл откроется повторно."

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Альтернативная клавиша"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Альтернативная клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Всегда"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Всегда игнорировать"

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Найден файл с дублирующимся именем"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Найден файл с дублирующимся именем: %s%s%s%sОн может быть перепутан с %s%s%s%s%sУдалить этот файл?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Найдены файлы с дублирующимися именами"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Найден модуль с дублирующимся именем"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Найден модуль с дублирующимся именем"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Редактор привязок - не выбран компонент"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Включена = Добавить %s к привязкам"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Привязки выбранных компонентов"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Привязка к нижней части соседа, сохранять зазор"

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Привязка к левой части соседа, сохранять зазор"

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Привязка к правой части соседа, сохранять зазор"

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Привязка к верхней части соседа, сохранять зазор"

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Во время загрузки %s при последнем запуске произошла ошибка!%s%sЗагрузить проект снова?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "Добавить краткое описание к подробному"

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Приложение%sГрафическая программа на LCL/Free Pascal. Исходный код программы автоматически поддерживается Lazarus."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Название класса приложения"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "использовать флаг сборки (-B) также для зависимостей"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Применять соглашения по именованию"

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Модуль проекта не может использоваться другими пакетами/проектами"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Зазор вокруг компонента. Остальные четыре значения зазоров добавляются к этому."

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Файл простой программы на Паскале.%sМожет использоваться для тестирования наспех.%sЛучше создайте новый проект."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Спросить перед заменой каждого фрагмента"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Спрашивать имя компонента при помещении его на форму"

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Спрашивать имя нового файла при его создании"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Спрашивать имя при создании"

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Автодополнение: выключено"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Автодополнение: включено"

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "Продолжать автоматически"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Продолжить после:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Подсветка и соответствия"

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr "Автоматически"

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "Автоматически преобразовывать файлы LFM в файлы LRS"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Автоматически вызывать после ввода точки"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "конца строки"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "пробела"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "конца слова"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "не добавлять сам символ"

#: lazarusidestrconsts.lisautomaticfeatures
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Автозавершение и подсказки"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Показывать инспектор объектов автоматически"

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Доступные пакеты"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Делать резервную копию изменённых файлов"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Резервирование не удалось"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Создаёт каталог для резервных копий в каталоге проекта"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Изменение имени пакета или версии нарушит зависимости. Требуется ли изменить их?%sНажмите Да, чтобы изменить все перечисленные зависимости.%sНажмите Пропуск, чтобы отбросить зависимости и продолжить."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "начинается"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "После связанных"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Всегда собирать перед запуском"

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Сборка"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Команда Собрать"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "При сборке проекта выполнить 'Собрать Файл'"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "При запуске проекта выполнить 'Запустить Файл'"

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Запуск"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Команда запуска"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Когда этот файл является текущим в редакторе исходного кода ..."

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Рабочий каталог (оставить пустым для пути к файлу)"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Рабочий каталог (оставить пустым для пути к файлу)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Выделять значения не по умолчанию жирным"

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "Зазор"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Вниз"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Нижний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства под компонентом."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Нижняя привязка"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Нижние края"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается нижняя граница. Оставьте пустым для родителя."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Равномерно по нижним краям"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Останов"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Параметры точки останова"

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Обзор (поиск компилятора) (%s)"

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Останов"

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Продолжить"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Найти"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Заменить"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "собрать все файлы проекта/пакета/IDE"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "собрать IDE с пакетами"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Сборка Lazarus не удалась"

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr "Макросы сборки"

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr "Макросы сборки:"

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "Режим сборки"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Различия между режимами сборки"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr "Отличия от других режимов сборки"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Режим:"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Режимы сборки"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Собрать новый проект"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Номер сборки"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Вызов %s для создания Makefile из %s не удался."

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Отменить загрузку этого компонента"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Отменить загрузку модуля"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Отменить переименование"

#: lazarusidestrconsts.liscannotcompileproject
#| msgid "Can not compile project"
msgid "Cannot compile project"
msgstr "Невозможно собрать проект"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Невозможно скопировать компонент верхнего уровня."

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Невозможно создать файл %s%s%s"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Невозможно найти пускатель Lazarus:%s%s"

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Возможно только изменить класс TComponents."

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Изменить класс %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "класс отсутствует"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Дублирующийся компилятор"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Проверьте тестовый каталог в %sОкружение -> Параметры окружения -> Файлы -> Каталог для сборки пробных проектов"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Компилятор \"%s\" не является исполнимым файлом.%sПодробности: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "содержит "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Копировать вывод в буфер обмена"

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Даты файлов .ppu FPC отличаются больше, чем на один час.%sЭто может означать, что они принадлежат разным установкам.%sФайл1: %s%sФайл2: %s"

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "отсутствует файл английских сообщений для FPC: components/codetools/fpc.errore.msg"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Ошибка"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ОШИБКА: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "путь к модулям FPC содержит файлы исходного кода: "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "символы конца строки"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "ПОДСКАЗКА: "

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Неверный компилятор"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Неверный путь поиска"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Неверный тестовый каталог"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Модуль отсутствует"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "откомпилированный модуль FPC не найден: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "найдено несколько конфигурационных файлов компилятора: "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "не найден fpc.cfg"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "символы не-ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "дублирующиеся ppu: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Откомпилированный модуль FPC %s.ppu не найден.%sОбычно это означает, что ваш fpc.cfg имеет ошибку, или FPC неверно установлен."

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Имеется более старый, чем компилятор, файл .ppu:%s%s"

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "fpc.cfg содержит относительный путь к модулям: %s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "В ваших путях имеется несколько компиляторов FreePascal.%s%s%sВозможно, вы забыли удалить старый компилятор."

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Пропуск"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "специальные символы"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Все тесты прошли успешно."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Невозможно создать тестовый файл"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Невозможно создать тестовый файл Паскаля \"%s\"."

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Невозможно получить дату %s."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "необычные символы"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Предупреждение"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ПРЕДУПРЕЖДЕНИЕ: "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "неверный разделитель пути"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Категории"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Сложность"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Константы"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Пустые блоки"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Пустые секции классов"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Пустые конструкции"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Пустые процедуры"

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Фильтр)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Следовать за курсором"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s в %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Является корневым"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr "\"Много\" параметров"

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Длинные процедуры"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "\"Много\" строк в процедуре"

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Много вложенных процедур"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Много параметров"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Показать категории"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Показать узлы исходного кода"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr "\"Много\" вложенных процедур"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Расположить компонент по центру по горизонтали относительно данного"

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Расположить компонент по центру по вертикали относительно данного"

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr "Поместить форму в центре"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Центр окна"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Центры"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Предпочтительный режим отображения"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Категории"

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr "Исходный код"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Никогда, только вручную"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Категории (только в режиме категорий)"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "При простое"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Обновлять автоматически"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Другое"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Обновление"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "При переключении файла в редакторе исходного кода"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Процедуры"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Свойства"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Опубликованные свойства без default"

#: lazarusidestrconsts.lisceshowcodeobserver
#| msgid "Show Code Observer"
msgid "Show observerations about"
msgstr "Сообщения смотрителя кода"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Стиль"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Элементы ToDo"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Типы"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Неименованные константы"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Несортированные члены"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Несортированные видимые"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Используемые модули"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Переменные"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Неверные отступы"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Сменить режим сборки"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Изменить класс"

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Смена кодировки"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Изменить файл"

#: lazarusidestrconsts.lischangeparent
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "Сменить родителя"

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Символ"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Таблица символов"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Проверять изменения на диске при загрузке"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "Проверить, что следующий элемент исходного кода - слово 'end', и, если нет, возвратить '<символы конца строки> + end; + <символы конца строки>'."

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Проверка параметров"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Выберите другое имя"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Выбор ссылки FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Выберите клавишу ..."

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Выберите имя нового компонента"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "Выберите файл Паскаля для получения образцов отступов"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Выберите файл сообщений компилятора"

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Выберите имя компилятора (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Выберите имя отладчика"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Выберите пакет Delphi (*.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Выберите проект Delphi (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Выберите модуль Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Выбор каталога"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Выберите каталог исходного кода FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Выберите каталог Lazarus"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Выберите путь make"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Выберите имя"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Выберите один из этих элементов для создания нового файла"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Выберите один из этих элементов для создания нового пакета"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Выберите один из этих элементов для создания нового проекта"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Выберите один из этих элементов для наследования от уже существующего"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Выберите файл исходного кода программы (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Выберите структуру для заключения в неё выделенного"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Выберите каталог для проб"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Завершение классов"

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Класс конфликтует с файлом .lfm:%sМодуль %s%sиспользует модуль %s,%sкоторый содержит класс %s,%sно файл .lfm уже содержит другой класс.%sВ модуле может быть только один такой класс.%sПереместите %s в другой модуль."

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Классы и свойства существуют. Значения не проверялись."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Класс %s%s%s не является зарегистрированным классом компонента.%sНевозможно вставить."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Класс не найден"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Класс %s%s%s метода %s%s%s не найден."

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистить каталог"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистить подкаталоги"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Оставить все текстовые файлы"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Сохранить файлы по фильтру"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Удалить файлы по фильтру"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простой синтаксис (например, * вместо .*)"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистить каталог исходного кода Lazarus"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Очистить путь к модулям?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Очистить каталог?"

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr "Удалить привязку клавиш"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Щёлкните здесь для выбора файла"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "Щёлкните для просмотра возможных вариантов использования"

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Закрыть"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Закрыть файлы"

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Скрыть окно"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Вы закрываете окно редактора исходного кода. Закрыть все файлы или скрыть окно?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Закрытие окна редактора исходного кода"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Параметры LCL, зависящие от интерфейса:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Параметр"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Компоненты"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Наследование"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Список"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Палитра"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Дублирующийся файл параметров компилятора"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Вызов при:"

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "сборке"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "компиляции"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "запуске"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sНажмите OK если уверены."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Код"

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Браузер кода"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "по умолчанию (%s)"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Параметры генерации кода"

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Добавить ссылку"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Добавить путь"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Обзор"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Подтвердите замену"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Создать элемент справки"

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Удалить ссылку"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Удалить путь"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Описание"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Ошибки"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Пример"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Вставить тег форматирования для полужирного шрифта"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Вставить тег форматирования для кода"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Вставить тег форматирования для курсива"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Вставить тег форматирования для замечания"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Вставить тег форматирования для подчёркнутого шрифта"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Вставить тег форматирования для имени переменной"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Унаследованное"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Вставить ссылку ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Вставить тег форматирования для абзаца"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(нет)"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(не найдено унаследованного описания)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<НЕТ>"

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "Путь к файлам FPDoc"

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "Заменить"

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Смотрите также"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Краткое описание"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Краткое"

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Показать пустые методы"

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr "Показать неиспользуемые модули"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgid "Ignore constants in next functions"
msgstr "Игнорировать константы в функциях:"

#: lazarusidestrconsts.liscodeobscharconst
msgid "Search for unnamed char constants"
msgstr "Искать неименованные константы-символы"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Смотритель кода"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgid "Ignore next unnamed constants"
msgstr "Игнорировать неименованные константы:"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Добавить"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Добавить шаблон кода"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Элемент %s%s%s уже существует! "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Автозавершение при обнаружении..."

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Изменить"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Комментарий:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Править шаблоны кода"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Ошибка"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Элемент:"

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Действие: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Автосоздаваемые элементы не могут ни редактироваться,%s ни содержать неавтосоздаваемые дочерние элементы"

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, автосоздан"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Автосоздаваемые элементы не могут редактироваться."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Блок"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Просмотр определений CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "путь к компилятору"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Преобразовать элемент"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Создать определения для каталога %s"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Создать определения для компилятора FreePascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Создать определения для исходного кода  FreePascal из SVN"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Создать определения для каталога Lazarus"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Создать определения для проекта %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Создать макросы FPC и пути к каталогу проекта FPC"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Определение"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Определить рекурсивно"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Удалить элемент"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s.%sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s,%sиспользуемые проектом %s.%sНапример: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Описание:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "Каталог %s"

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Правка"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Ошибка чтения %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Ошибка чтения файла сведений проекта %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Ошибка записи %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Ошибка записи проекта в файл %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Выход"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Выход без сохранения"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Каталог исходного кода  FreePascal из SVN"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Каталог"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставить шаблон каталога Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставить шаблон проекта Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставить шаблон каталога Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставить шаблон проекта Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставить шаблон каталога Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставить шаблон проекта Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставить шаблон компилятора FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставить шаблон проекта FreePascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Вставить шаблон SVN-кода FreePascal "

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставить шаблон компилятора Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставить шаблон каталога Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставить шаблон проекта Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Вставить шаблон каталога Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставить элемент как дочерний"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставить элемент ниже"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставить шаблон"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неверный родитель"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неверный родительский элемент"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неверный предыдущий элемент"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установил все исходные коды %s,%sиспользуемые проектом %s.%sНапример: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Переместить элемент вниз"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Переместить элемент на уровень вниз"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Переместить элемент на уровень вверх"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Переместить элемент вверх"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Имя:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новый элемент"

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Элемент и его \"потомки\" доступны только для этого проекта"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Элемент только для чтения"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Ничего не выбрано"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Родительский элемент не может содержать дочерних."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Предыдущий элемент не может содержать дочерних."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Имя каталога проекта"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Каталог проекта %s"

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, связан с проектом"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Сохранить и выйти"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Выделить элемент:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Каталог исходного кода  FreePascal из SVN. Не обязателен. Улучшит поиск объявлений и отладку."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Каталог проекта FreePascal."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Каталог исходного кода  FreePascal из SVN."

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Главный каталог Lazarus."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Путь к компилятору FreePascal.%s Например, %s/usr/bin%s -n%s или %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Путь к компилятору FreePascal для данного проекта. Требуется только при заполненном поле \"Каталог исходного кода FreePascal из SVN\" ниже. Используется для автоматического создания макросов."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Каталог %s проекта,%sсодержащий файлы .dpr, dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Снять определение"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Снять определение со всех"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно снять определение"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значение как пути к файлам"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значение как текст"

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Переменная:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Ошибка записи"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Оператор @"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Скобка"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Двоеточие"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Запятая"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Идентификатор"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключевое слово"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новая строка"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Число"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "ОК"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Точка"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Точка с запятой"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Пробел"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Строковая константа"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Выполнить после компиляции"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Выполнить перед компиляцией"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Свернуть все классы"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Свернуть все пакеты"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Свернуть все модули"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Команда после"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Команда \"после\" некорректна"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Команда после установки модуля"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметры командной строки программы"

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Компиляция IDE (без компоновки)"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Компилятор"

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Ошибка компилятора"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Ошибка: неверный компилятор:%s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Имя файла компилятора"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Подсказка: Вы можете задать путь компилятора в Окружение->Параметры окружения->Файлы->Путь компилятора"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАМЕТКА: файл параметров CodeTools не найден, поэтому используются значения по умолчанию"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАМЕТКА: загружается старый файл параметров CodeTools: "

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Параметры компилятора для проекта: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (идёт компиляция ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Отображение длинных подсказок"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Удлинять далеко влево"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Удлинять немного влево"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Никогда"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Удлинять только вправо"

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "Компонент"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr "Имя компонента \"%s\" является ключевым словом Паскаля."

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Имя компонента %s%s%s зарезервировано"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Имя компонента %s%s%s не является корректным идентификатором"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Найти компонент"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Открыть пакет"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Открыть модуль"

#: lazarusidestrconsts.liscomptest
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Тест"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Условие"

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr "Условные определения"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Каталог конфигурации Lazarus"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Параметры сборки %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Параметры %sСборки Lazarus%s"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus будет пересобран по следующим профилям:%sПродолжить?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Подтвердить изменения"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Подтвердите удаление"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Вы хотите пересобрать Lazarus по профилю: %s ?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Подтвердите новый набор пакетов для IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Действие"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Новый набор пакетов"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Старый набор пакетов"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Консольное приложение"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Код конструктора"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "содержит"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "С учётом контекста"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Продолжить"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Продолжить и больше не спрашивать"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Продолжить, не загружая форму"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Участники"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Элемент управления требует \"родителя\""

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Добавление смещения к координатам виджетов внутри визуальных контейнеров"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Смещения координат"

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr "Прервано."

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr "Поиск файлов модулей будет производиться во всех подкаталогах"

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr "В данный момент не должно быть отсутствующих модулей!"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "Ошибка BeginCodeTools!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Категории:"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Преобразование прервано."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Преобразование завершено."

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Преобразование пакета Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Преобразование проекта Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
#| msgid "Convert Delphi Unit"
msgid "Convert Delphi unit"
msgstr "Преобразование модуля Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr "Преобразование файла модуля %s"

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr "*** Преобразование файлов модулей... ***"

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr "Главный файл пакета Delphi (.dpk) не найден для пакета%s%s"

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Ошибка=\"%s\""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr "%s(%s,%s) Ошибка: невозможно найти модуль %s"

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Не удалось преобразовать модуль"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "Не удалось преобразовать модуль%s%s%s"

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr "*** Поиск всех файлов модулей... ***"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Функция Delphi"

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr "Оставить оба"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) отсутствует включаемый файл"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Имя Delphi"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Имя пакета уже существует"

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr "Готово."

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr "Модуль \"%s\" удалён из выражения Uses."

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr "Удалить первый"

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr "Удалить второй"

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr "Исправление файла формы %s"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr "*** Исправление файлов форм... ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Модуль \"%s\" в выражении Uses заменён на \"%s\"."

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr "Пропустить этот файл"

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr "Пропустить этот шаг"

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr "Некоторые модули пакета Delphi отсутствуют:%s%s"

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr "Имеется два модуля с одинаковыми именами:%s%s%s%s%s"

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Пакет с именем \"%s\" уже имеется.%sСначала закройте его."

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr "Имя модуля повторяется"

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr "Модули не найдены"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Модули для замены в %s"

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Ошибка преобразования"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Преобразовать"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Преобразование кодировки"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Преобразовать кодировку проектов/пакетов"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Преобразование проекта либо пакета"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Добавление директив условной компиляции для поддержки различных целей"

#: lazarusidestrconsts.lisconverttargetlaz
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lisconverttargetlazanddelphi
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr "Lazarus и Delphi"

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr "Lazarus и Delphi с общим файлом DFM"

#: lazarusidestrconsts.lisconverttargetlazwinonly
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr "Только Lazarus для Windows"

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Замена функций"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Некоторые функции Delphi могут быть заменены функциями LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Заменяемые функции/процедуры"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Смещение слева"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Новое имя"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Родительский контейнер"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Смещение сверху"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Замена типов"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Неизвестные типы в файле формы (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Заменяемые типы"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Замена модулей"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Имена модулей в выражении Uses исходного модуля"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Заменяемые модули"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Неизвестные свойства"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Копировать все"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr "Копировать все строки в буфер обмена"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Копировать весь вывод в буфер обмена"

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr "Копировать все показанные и скрытые сообщения в буфер обмена"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr "Копировать все показанные сообщения в буфер обмена"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Копировать описание в буфер обмена"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Ошибка копирования"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Копировать %s%s%s в буфер обмена"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копирование всей формы не реализовано."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr "Копировать строку в буфер обмена"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr "Копировать выделенные строки в буфер обмена"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Копировать выделенные сообщения в буфер обмена"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Искать сообщения FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Искать сообщения Make"

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Показывать все сообщения"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Пропуск вызова компилятора"

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Частные параметры целевой ОС"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Не удалось добавить %s{$I %s%s} в главный файл исходного кода!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Не удалось добавить %s{$R %s%s} в главный файл исходного кода!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Не удалось добавить %s%s%s в главный файл исходного кода!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Не удалось удалить %s%s%s из главного файла исходного кода!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Не удалось удалить %s{$I %s%s} из главного файла исходного кода!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Не удалось удалить %s{$R %s%s} из главного файла исходного кода!"

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (другое)"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Внимание: дополнительный файл настроек компилятора имеет то же имя, что один из стандартных файлов настроек компилятора FreePascal. Это приведёт к использованию дополнительного файла и пропуску стандартного."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Открыть пакет %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Открыть модуль %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Сначала необходимо создать проект!"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Создать каталог?"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Создать функцию"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Создать элемент справки"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Создать его"

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Создать новый проект"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Создать проект"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Создавать/обновлять файлы PO при сохранении файла LFM"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Создание индекса файлов исходного кода FPC %s ..."

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Выберите каталог"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметры каталогов CodeTools"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Задать шаблоны"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не выбрано переменных>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Открыть предпросмотр"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Средства"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Переменная: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Имя переменной"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Шаблоны"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "Выберите макрос"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Выбрать макрос кода"

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr "Текущий"

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Номер столбца под курсором в текущем редакторе"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Номер строки под курсором в текущем редакторе"

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr "Пользовательские макросы сборки"

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "параметры пользователя"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Параметры пользователя"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Программа пользователя"

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Программа пользователя%sПрограмма на языке Free Pascal."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Модуль данных"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Дата"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Удалить все"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Удалить все"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Отключить все"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Отключить все"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Включить все"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Включить все"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr "Копировать в буфер обмена"

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Удалить"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Отключить"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Отключить"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Включить"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Включить"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Отладчик не указан"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Установить точку останова всё равно"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Не указан отладчик.%sТочки останова не будут иметь эффекта, пока вы не настроите отладчик в диалоге \"Параметры отладчика\" в меню."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Вкл./выкл."

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Отключить/включить обновления для всего окна"

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Ошибка отладчика"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Ошибка отладчика%sОп, отладчик находится в нерабочем состоянии%sСохраните работу!%sНажмите Стоп и надейтесь на лучшее!"

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неверный отладчик"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (идёт отладка ...)"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Добавить исключение"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Дополнительный путь поиска"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Точка останова"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Очищать журнал при запуске"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Отладчик"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Общие параметры отладчика"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Частные параметры отладчика (зависят от типа отладчика)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Имя исключения уже существует"

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Введите имя исключения"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Журнал событий"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Обрабатывается"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Обрабатывается отладчиком"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Обрабатывается программой"

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Игнорировать эти исключения"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Исключения языка"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Максимальное число строк"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Модуль"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Имя"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Уведомлять об исключениях Lazarus"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Исключения ОС"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Вывод"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Процесс"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Продолжить"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Продолжить при обработанных"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Продолжить при необработанных"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Показывать сообщение при остановке"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Сигналы"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Тред"

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Окно"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Невозможно загрузить файл"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Невозможно загрузить файл %s%s%s."

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr "Десятичное"

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "Значение по умолчанию"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Задержка вывода длинных подсказок в окне автозавершения"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Задержка вывода подсказок и окна автозавершения"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Удалить все"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Удалить все точки останова?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Удалить все точки останова в файле %s%s%s?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Удалить все в том же файле исходного кода"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Удалить все выбранные точки останова?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Удалить все эти файлы?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Удалить файл с дублирующимся именем?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Удалить точку останова"

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Удалить точку останова в%s\"%s\" на строке %d?"

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr "Удалить макрос сборки %s%s%s?"

#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr "Удалить режим сборки"

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "Удалить режим сборки?"

#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr "Удалить режим сборки %s%s%s?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Удаление файла не удалось"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr "Удалить макрос %s"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Удалить режим \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Удалить старый файл %s%s%s?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Удалить старый файл?"

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "Удалить строку"

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Удалить выбранные файлы"

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr "Удалить параметр"

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr "Удалить параметр?"

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr "Удалить параметр %s%s%s?"

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Удалить значение %s%s%s?"

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Удалить значение %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Удаление файла  %s%s%s не удалось."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Пакет Delphi"

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Проект Delphi"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Модуль Delphi"

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Компонент с именем %s%s%s уже имеется."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Каталог назначения"

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Каталог %s%s%s некорркетен.%sВыберите путь к компилятору."

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Код деструктора"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Игнорировать регистр"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Игнорировать добавление/удаление пустых строк"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Игнорировать разные концы строк (например, #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Игнорировать количество пробелов"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Игнорировать пробелы (без учёта символов перевода строки)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Игнорировать пробелы в конце строки"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Игнорировать пробелы в начале строки"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Только выбранное"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Открыть Diff в редакторе"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Текст1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Текст2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Разряды:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Директивы"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Директивы в новом модуле"

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Каталог %s%s%s не найден."

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Каталог недоступен для записи"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Каталог, в котором IDE размещает файлы PO"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Отключить все в том же файле исходного кода"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Отключить точку останова"

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Отключено"

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr "Отключить группу"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Отключить i18n для LFM"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Ассемблер"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr "Перейти по адресу"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr "Перейти по адресу"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr "Перейти по текущему адресу"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr "Перейти по текущему адресу"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Отбросить изменения"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Отбросить все изменения"

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Изменённые файлы:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Выберите один из элементов выше, чтобы увидеть разницу"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Ошибка чтения файла: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Игнорировать изменения на диске"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Перегрузить с диска"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Некоторые файлы изменены на диске:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Различать регистр букв, например, А и а"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Редактор документации"

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s не существует: %s"

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Не закрывать IDE"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Не закрывать проект"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "не собирать зависимости"

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr "Не устанавливать"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Не показывать начальную заставку"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Не показывать этот диалог для данного проекта"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Больше не показывать это сообщение"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Отображать линии сетки"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Копировать выбранные компоненты в буфер"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Переместить компонент на один назад"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Переместить компонент на один вперёд"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Переместить компонент назад"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Переместить компонент вперёд"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставить выбранные компоненты из буфера"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Выбрать родительский компонент"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Значение %s%s%s уже существует."

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Дублирующееся имя: Компонент с именем %s%s%s уже существует в унаследованном компоненте %s"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Путь поиска уже существует"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Редактировать контекстно-зависимую справку"

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Выбрать схему"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Все пакеты"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Текущий проект"

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Каталог текущего проекта"

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Добавляемый глобальный путь к исходному коду"

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Путь вкл.проекта"

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Путь к исходному коду проекта"

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Путь к модулям проекта"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Все проекты"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "установить режим FPC в DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "установить режим FPC в FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "установить режим FPC в GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "установить режим FPC в MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "установить режим FPC в TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "Включить IOCHECKS"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Включить OVERFLOWCHECKS"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Включить RANGECHECKS"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "использовать модуль HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "использовать модуль LineInfo"

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Корректное средство обязательно должно иметь заголовок и имя файла."

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Параметры пользовательского средства"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Скрывать главную форму"

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Вставить"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Клавиша"

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Макросы"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметры:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Имя файла программы:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Поиск сообщений компилятора FreePascal в выводе"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Поиск сообщений make в выводе"

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Требуются заголовок и имя файла"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Рабочий каталог:"

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Все"

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Пустые методы"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Найденные пустые методы:"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Только published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Удалить методы"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Искать в следующих секциях класса"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Пусто"

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Включить все"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Включить все в том же файле исходного кода"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Включить точку останова"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Включить"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr "Включить группу"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Включить поддержку интернационализации и локализации"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Включить макросы"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Заключить"

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Файл %s%s%s%sна диске имеет кодировку %s. Новой кодировкой будет %s."

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Файл %s%s%s%sна диске имеет кодировку %s. Новой кодировкой будет %s."

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Введите язык перевода"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Переменная окружения, имя как параметр"

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Переходить с сообщения на строку кода по двойному щелчку (а не по одинарному)"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Каталог не найден"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Каталог исходного кода FPC \"%s\" не найден."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Некорректное имя компилятора"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Файл компилятора \"%s\" не является исполнимым."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некорректное имя отладчика"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл отладчика \"%s\" не является исполнимым."

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Каталог с исходным кодом FPC \"%s\" имеет некорректную структуру. Обычно он содержит такие подкаталоги, как rtl/inc, packages/fcl-base, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Каталог Lazarus \"%s\" выглядит некорректно. Обычно он содержит каталоги lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Неверное имя файла Make"

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Файл Make \"%s\" не является исполнимым."

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Каталог Lazarus \"%s\" не найден."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Каталог проб \"%s\" не найден."

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "ПРИМЕЧАНИЕ: в настоящий момент поддерживаются только абсолютные пути"

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Ширина ТАБа"

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Неверный параметр в позиции %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Параметр в позиции %d не разрешает аргумент: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Параметр в позиции %d требует аргумент: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Ошибка:"

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Ошибка создания файла"

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Ошибка создания lrs"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Ошибка удаления файла"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Ошибка в %s"

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Ошибка инициализации программы %s%s%s%s%sОшибка: %s"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Ошибка загрузки файла"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Ошибка загрузки файла \"%s\":%s%s"

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Ошибка при загрузке %s из%s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Ошибка перемещения компонента"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Ошибка перемещения компонента %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Ошибка при именовании компонента"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Ошибка при открытии компонента"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Ошибка разбора потока компонента lfm."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Ошибка чтения списка пакетов из файла%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Ошибка чтения XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Ошибка чтения файла XML %s%s%s%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Ошибка переименования файла"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Ошибки"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Ошибка при сохранении %s в%s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Ошибка установки имени компонента %s в %s"

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Ошибка записи списка пакетов в файл%s%s%s%s"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Настройка пользовательских сканеров (%s)"

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr "Вычислить выражение"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "&Вычислить"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Каждый n-ный номер строки:"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Файл с образцами:"

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Примеры"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Примеры:%s<Идентификатор>%sTMyEnum.<Перечисление>%s<Имя модуля>.<Идентификатор>%s#<Имя пакета>.<Имя модуля>.<Идентификатор>"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Уведомление об исключении отладчика"

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Исключающий фильтр"

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "Исключающий фильтр"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Выполнить команду после"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Выполнить команду до"

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Выполнение приостановлено"

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Выполнение остановлено%s Адрес: %s%s Процедура: %s%s Файл: %s%s(Когда-нибудь здесь появится окно ассемблера :)%s"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Выполнение остановлено"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Программы"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Развернуть все классы"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Развернуть все пакеты"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Развернуть все модули"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Полное имя файла в данном редакторе"

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Экспортировать ..."

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Список экспорта"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Выражение:"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Расширить пути к модулям?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Извлечь"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Внешние средства"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Не удалось запустить средство"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Достигнут максимум количества средств"

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Вниз"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Вверх"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Удалить"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Допускается максимум %s средств."

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "Действие \"%s\" завершено"

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Невозможно запустить средство %s%s%s:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Не удалось создать Application Bundle для \"%s\""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Не удалось загрузить состояние сворачиваний кода."

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Уменьшить прорисовку дизайнеров"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Рисовать элементы дизайнеров только в паузах (уменьшает нагрузку на медленных машинах)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне похож на текстовый.%sВсё равно открыть?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл %s%s%s%sне похож на текстовый.%sВсё равно открыть?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Расширение файла программы"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Фильтр файлов"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Файл %s%s%s был изменён. Сохранить?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Файл не имеет проекта"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Файл недоступен для записи"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Файл является символической ссылкой"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Файл %s%s%s виртуальный."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Ошибочная ссылка на файл"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Имя файла/Адрес"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Файл не найден"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Файл %s%s%s не найден.%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Файл %s%s%s не найден.%sСоздать его?%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижнем регистре"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Файл не текстовый"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "Параметры файла"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Файлы в кодировке ASCII либо UTF-8"

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Файлы не в кодировке ASCII и не в UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "файл, куда записывается вывод отладки. Если он не указан, вывод отладки записывается в консоль."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Фильтр"

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(фильтр)"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Фильтр: %s"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Наборы фильтров"

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Учитывать регистр"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Параметры каталогов"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Маска файла (*;*.*;*.bak?)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Искать в подкаталогах"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Многострочный &шаблон"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Только текстовые файлы"

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Регулярные выражения"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "искать во всех &файлах проекта"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "искать во всех &открытых файлах"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "искать в &каталогах"

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Искать текст:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Где"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "&Только целые слова"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Найти комбинацию клавиш"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Поиск отсутствующего модуля"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "В начале"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Исправить файл LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "С плавающей точкой"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Переименовать принудительно"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Форма"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Ошибка форматирования"

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Ошибка загрузки формы"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "ошибка fpcmake"

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Компоненты"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Ресурсы FPC"

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Ошибка каталога исходного кода FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "Слишком старая версия FPC"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Версия FPC: "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Версия FPC (например, 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "При записи \"%s\" произошла ошибка%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Синтаксическая ошибка FPDoc"

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "В элементе FPDoc \"%s\" имеется синтаксическая ошибка:%s%s"

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Найти компонент на палитре"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Фрейм"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Назад"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Компилятор FreePascal не найден"

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Программа Free Pascal, использующая TCustomApplication для лёгкой проверки параметров командной строки, обработки исключений и т. д. Исходный код программы автоматически поддерживается Lazarus."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Каталог исходного кода FreePascal"

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Файл исходного кода FreePascal"

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Не найден исходный код FreePascal"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "&Вперёд"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Дополнительные файлы для поиска (пример: /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Найти или переименовать идентификатор"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Найти ссылки"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Идентификатор: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "во всех открытых пакетах и проектах"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "в текущем модуле"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "в главном проекте"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "в проекте/пакете, содержащем этот модуль"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некорректный идентификатор"

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Переименовать"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Переименовать все ссылки"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Переименовать в"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Искать и в комментариях"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Искать где"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "Функция"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "Возвратить слово в текущей позиции курсора"

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr "Переход к строке"

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Перейти к выделенной строке исходного кода"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Группа"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Увеличить до наибольшего"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Имеет справку"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Комментарий перед заголовком класса"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Элементы справки"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Выбор справки..."

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Шестнадцатеричное"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Справка по сообщениям компилятора FreePascal"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "Скрыть сообщение с помощью директивы"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Подсказка: значение по умолчанию может быть задано условными определениями."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Подсказка: проверьте, содержат ли два пакета модули с одинаковым именем."

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "Подсказка: для редактирования команды дважды щёлкните по ней мышью"

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Открыть"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "Приостановить"

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Запустить"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Сохранить все"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Шаг со входом"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Исполнять до выхода из функции"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Шаг в обход"

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Остановить"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите выражение и попробуйте снова."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Подсказка: функция Создать строку ресурсов требует строковой константы.%sВыберите только строковое выражение и попробуйте снова."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Показать формы"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Показать модули"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Число срабатываний"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Базы данных"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметры справки"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Свойства:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Программы просмотра"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Путь к  HTML-документации FPC"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Горизонтально"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Параметры сборки IDE"

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Создание Makefile для пакета %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Ошибка: для пакета %s не удалось запустить средство, определённое для выполнения после компиляции"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Информация об IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "ПРЕДУПРЕЖДЕНИЕ: некорректное имя модуля %s, пакет %s"

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "Интерфейс IDE"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "идентификатор"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Идентификатор начинается с ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Идентификатор содержит ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Параметры IDE:"

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "Отображать каталог проекта в заголовке IDE"

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Начинать заголовок IDE с имени проекта"

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Ошибка доступа к XML"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Ошибка доступа к файлу XML %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Ошибка загрузки XML"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Ошибка загрузки файла XML %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Файл экспорта уже существует"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Файл экспорта %s%s%s уже существует.%sОткрыть его и заменить только параметры компилятора?%s(Остальные параметры не будут затронуты.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Загрузить из файла"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Открыть или загрузить параметры компилятора"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Открыть недавние"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Недавние файлы"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Сохранить в файл"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Сохранить в недавних"

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "ОК"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Игнорировать все"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Игнорировать и продолжить"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Игнорировать двоичные файлы"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Игнорировать этот тип исключений"

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Игнорировать отсутствующие файлы"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Игнорировать, использовать TForm как предка"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Следовать отступам в текущем модуле, проекте или пакете"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Комментарий перед реализацией класса"

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Список импорта"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Невозможно"

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Включающий фильтр"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "путь включаемых"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Пути включаемых"

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "Отступы"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "Отступы исходного кода на Паскале"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Индекс"

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr "Прервано..."

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Компиляция проекта"

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "Компиляция..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr "Ошибка..."

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Ошибок:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Подсказок:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Строк:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Прервать"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Заметок:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Проект:"

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "Успешно..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Предупреждений:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Сведения"

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Информация о %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Информация об используемом компиляторе FPC"

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Перед связанными"

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr "Унаследованный компонент"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Унаследованный объект"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Для создания очищенной копии проекта/пакета все файлы в следующем каталоге будут удалены, и всё их содержимое будет утеряно.%s%sУдалить все файлы в %s%s%s?"

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Вставить дату"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Вставить дату и время"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Вставить дату и время. Возможно форматирование строки."

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Вставить дату. Возможно форматирование строки."

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Вставить при необходимости слово 'end'"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Вставить макрос"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Вставить имя текущей процедуры."

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Вставить тег вывода краткого описания"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Вставить тег вывода краткого описания"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Вставить заголовок процедуры"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Вставить имя процедуры"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "Вставить время"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Вставить время. Возможно форматирование строки."

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Вставить тег URL"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "В сессии"

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Просмотреть"

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Данные"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Инспектор отладки"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Методы"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Свойства"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Установка не удалась"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Установить, я люблю полных"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Установить выбранное"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr "Установка/удаление пакетов"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Интерактивный режим"

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr "Макрос сборки %s%s%s некорректен. Он должен являться идентификатором Паскаля."

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr "Макрос сборки \"%s\" некорректен. Имя является ключевым словом."

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "Неверная круговая зависимость"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Неверная команда"

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Неверное имя файла компилятора"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Недопустимое удаление"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Неверный каталог назначения"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Неверное выражение:%s%s%s%s"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неверное выражение.%sПодсказка: функция \"Создать строку ресурсов\" требует строковую константу в одном файле. Выделите выражение и попробуйте ещё."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Неверный фильтр"

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Неверный каталог исходого кода FreePascal"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Неверные строка, столбец в сообщении%s%s"

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Режим %s некорректен"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неверное множественное выделение"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Неверная (Выкл.)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Неверная (Вкл.)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некорректный идентификатор Паскаля"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Имя \"%s\" не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неверное имя процедуры"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неверное имя файла проекта"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Неверный каталог публикации"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Неверное выделение"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr "%s является группой. Параметр может быть добавлен только в обычный режим сборки."

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s уже принадлежит проекту."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s не является корректным именем проекта.%sВыберите другое (например, project1.lpi)."

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s является %s.%sТакая круговая зависимость не разрешена."

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr "История переходов"

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "JIT Form"

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "оставить"

#: lazarusidestrconsts.liskeepfileopen
#| msgid "Keep converted file open in editor"
msgid "Keep converted files open in editor"
msgstr "Оставлять преобразованные файлы открытыми в редакторе"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Все файлы проекта будут открыты в редакторе после преобразования"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Оставить в списке на установку"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Сохранить имя"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Оставить их и продолжить"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Команды пользователя"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Команды дизайнера"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Команды инспектора объектов"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Прервать сборку"

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Добавить текущий модуль к проекту"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Добавить наблюдение"

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Собрать все файлы проекта/программы"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Собрать проект/программу"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Выберите схему привязки клавиш"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Классическая"

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Закрыть всё"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Закрыть проект"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Параметры CodeTools"

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Параметры компилятора"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Параметры %sсборки файла%s"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Настройка пользовательских компонентов"

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Параметры справки"

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Установить/удалить пакеты"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Контекстно-зависимая справка"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Преобразовать пакет Delphi в пакет Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Преобразовать проект Delphi в проект Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Преобразовать модуль Delphi в модуль Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Преобразовать файл DFM в LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Копировать выбранные компоненты в буфер обмена"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер обмена"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Удалить последний символ"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Сравнить открытые в редакторе файлы"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Редактировать шаблоны кода"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Редактировать контекстно-зависимую справку"

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Параметры редактора"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Вычислить/Изменить"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Настройка внешних средств"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Найти далее"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Перейти к закладке 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Перейти к закладке 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Перейти к закладке 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Перейти к закладке 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Перейти к закладке 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Перейти к закладке 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Перейти к закладке 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Перейти к закладке 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Перейти к закладке 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Перейти к закладке 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Перейти к редактору исходного кода 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Перейти к редактору исходного кода 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Перейти к редактору исходного кода 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Перейти к редактору исходного кода 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Перейти к редактору исходного кода 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Перейти к редактору исходного кода 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Перейти к редактору исходного кода 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Перейти к редактору исходного кода 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Перейти к редактору исходного кода 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Перейти к редактору исходного кода 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Вставить дату и время"

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Вставить $IFDEF"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Вставить имя пользователя"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Просмотреть"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Схема привязки клавиш"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (по умолчанию)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (стиль Apple)"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (стиль Lazarus)"

#: lazarusidestrconsts.liskmnewpackage
msgctxt "lazarusidestrconsts.liskmnewpackage"
msgid "New package"
msgstr "Новый пакет"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Нрвый проект "

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Новый проект из файла"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Создать модуль"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Внимание: все клавиши получат значения выбранной схемы."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Открыть файл пакета"

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "Диаграмма пакетов"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Вставить компоненты из буфера обмена"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Приостановить программу"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Опубликовать проект"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Быстрая компиляция, без компоновки"

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Удалить текущий модуль из проекта"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Запустить программу"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Сохранить всё"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Сохранить как"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Сохранить проект"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Сохранить проект как"

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Выделить до конца строки"

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Выделить до начала строки"

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Выделить страницу снизу"

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Выделить страницу сверху"

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Выделить слово слева"

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Выделить слово справа"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Добавить закладку 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Добавить закладку 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Добавить закладку 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Добавить закладку 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Добавить закладку 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Добавить закладку 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Добавить закладку 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Добавить закладку 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Добавить закладку 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Добавить закладку 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Остановить программу"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Переключиться между модулем и формой"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Переключить закладку 0"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Переключить закладку 1"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Переключить закладку 2"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Переключить закладку 3"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Переключить закладку 4"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Переключить закладку 5"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Переключить закладку 6"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Переключить закладку 7"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Переключить закладку 8"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Переключить закладку 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr "Показать окно ассемблера"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Показать точки останова"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Показать стек вызовов"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Показать обозреватель кода"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Показывать палитру компонентов"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
#| msgid "Toggle view Debug Events"
msgid "Toggle view Debuger Event Log"
msgstr "Показать окно журнала событий отладчика"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Показать вывод отладчика"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Показать редактор документации"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Показывать кнопки быстрого запуска IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Показать локальные переменные"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Показывать окно сообщений"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Показывать инспектор объектов"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr "Показать окно регистров"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Показать результаты поиска"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Показать редактор исходного кода"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Показать окно наблюдений"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Показать историю переходов"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Показать параметры проекта"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Показать исходный код проекта"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Показать информацию о модуле"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Запускающее приложение недопустимо"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командная строка для запуска"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Установки Рабочего Стола Lazarus"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Каталог Lazarus"

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Каталог Lazarus не найден"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "каталог для использования в качестве базового"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "Файл Lazarus"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Форма Lazarus"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE Lazarus"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Включаемый файл Lazarus"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID языка Lazarus (пример: en, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Название языка Lazarus (пример: английский, немецкий)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [параметры] <имя файла проекта>"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Пакет Lazarus"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Проект Lazarus"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Файл информации проекта Lazarus"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Исходный код проекта Lazarus"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Модуль Lazarus"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Действие"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Выберите каталог для вывода исполнимого файла IDE "

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "Часть"

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Добавить"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Расширенные параметры сборки"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Вы действительно хотите удалить этот профиль сборки?"

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Собрать"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr "Собрать расширенно"

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Собрать CodeTools"

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Собрать компоненты (SynEdit, CodeTools)"

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "Собрать примеры"

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Собрать IDE"

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Собрать JITForm"

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Собрать SynEdit"

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Очистить все"

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Очистить+Собрать"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Общие параметры"

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr "Включить выбранные пакеты в исполнимый файл Lazarus статически"

#: lazarusidestrconsts.lislazbuildconfirmbuild
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "Спрашивать перед пересборкой"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Подтвердите удаление"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Определения"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Определения без -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Редактировать определения"

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr "Редактирование определений"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Редактировать список определений для использования любым профилем"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Ошибка записи файла"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild неинтерактивен, остановка."

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr "Аналог команды \"make clean\" в командной строке"

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Управление профилями сборки"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Управление профилями"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Имя активного профиля"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Добавление нового профиля"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Текущие параметры сборки будут сохранены в профиле:"

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Нет"

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "ОК"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Параметры:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Параметры, передаваемые компилятору"

#: lazarusidestrconsts.lislazbuildprofile
#| msgid "Build Profile"
msgid "Profile to Build"
msgstr "Профиль сборки"

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr "Собрать все"

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "Собрать IDE без пакетов"

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "Собрать IDE с пакетами"

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "Собрать LCL"

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Очистить + Собрать все"

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Обновить"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Удалить"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Переименовать"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Переименование профиля"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Новое имя профиля:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "Перезапускать после сборки IDE"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Перезапускать Lazarus автоматически после сборки IDE (не действует при сборке прочих частей среды разработки)"

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Сохранить параметры"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Выбор профилей для сборки"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Выводить диалог подтверждения при пересборке напрямую из меню Сервис"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Целевой CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Каталог назначения:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Целевая ОС:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Невозможно записать файл \"%s\":%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Обновить revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Обновить информацию о ревизии в диалоге \"О проекте Lazarus\""

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr "С пакетами"

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Отсутствует путь модуля LCL"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Библиотека виджетов LCL"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Добавить ссылку на унаследованное"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Копировать из унаследованного"

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s не содержит ни одного корректного пути LazDoc.%sНевозможно создать файл FPDoc для %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Переместить в унаследованное"

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Корректные пути LazDoc отсутствуют"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Модулем %s не владеет ни один из пакетов либо проектов.%sДобавьте модуль к пакету либо проекту.%sНевозможно создать файл FPDoc."

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Оставьте пустым для файла .po по умолчанию"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Стрелка влево"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Левый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства слева от компонента."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Левая привязка"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается левая граница. Оставьте пустым для родителя."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Левые края"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Равномерно по левым краям"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Уровни"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Файл LFM"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Файл LFM повреждён"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "Файл LFM верен"

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Библиотека%sБиблиотека Free Pascal (.dll в Windows, .so в Linux, .dylib в MacOS X). Исходный код библиотеки автоматически поддерживается Lazarus."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "путь к библиотекам"

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Строка:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Строка/Длина"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Ссылка:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "параметры компоновщика"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Объект ссылки"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "Список всех значений оператора case"

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Загрузка %s не удалась."

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Локальные"

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Имя"

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr "Сообщение в журнал"

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Логотип"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Преобразовать регистр строки в нижний"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Преобразовать регистр строки, переданной в качестве параметра, в нижний."

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "Файлы LRS"

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Макрос %s"

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr "Имя макроса"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Введите данные"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введите параметры запуска"

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr "Значение макроса"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Главный модуль имеет выражения Application.CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Главный модуль имеет выражение Application.Title"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Главный модуль имеет выражение uses, включающее все модули проекта"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Главный модуль является исходым кодом на Паскале"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Исполнимый файл Make"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Не найден Make"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Добавить к секции"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Строка ресурсов %s%s%s уже есть. %sВыберите другое имя. %s Используйте Пропуск, чтобы добавить как есть."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Параметры преобразований"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Пользовательский ID"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Идентификатор"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Длина идентификатора:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Префикс идентификатора:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставить по алфавиту"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставить с учётом контекста"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неверная секция Resourcestring"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Выберите секцию resourcestring из списка."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Строка ресурсов уже существует"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Секция Resourcestring:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Предпросмотр исходного кода"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Строковая константа в исходном коде"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Строки с тем же значением:"

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Макс. %d"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Дамп памяти"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Прервать сборку"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Информация о компиляторе FPC"

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Точка останова в исходном коде"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Добавить точку останова"

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Добавить активный модуль к проекту"

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Добавить точку перехода в историю"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Добавить файл редактора в проект"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Добавить наблюдение..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Разбить строки в выделенном"

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Собрать"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Собрать все"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Собрать файл"

#: lazarusidestrconsts.lismenubuildlazarus
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "Собрать Lazarus по текущему профилю"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr "Пересобрать Lazarus по профилю: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Проверить файл LFM в редакторе"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Очистить каталог ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Закрыть"

#: lazarusidestrconsts.lismenucloseall
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "&Закрыть все файлы редактора"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Закрыть проект"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Редактор определений CodeTools ..."

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Собрать файлы .po"

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Закомментировать"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Параметры компилятора ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Завершить код"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Вставить $IFDEF..."

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Параметры сборки+запуска ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Настройка пользовательских компонентов ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Настроить внешние средства ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Параметры сборки Lazarus ..."

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Параметры справки ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Контекстно-зависимая справка"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Преобразовать пакет Delphi в пакет Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Преобразовать проект Delphi в проект Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Преобразовать модуль Delphi в Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Преобразовать двоичный файл DFM в текстовый LFM и проверить синтаксис ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Преобразовать кодировку проектов/пакетов ..."

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Копировать"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Создать файлы FPDoc"

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Создать файлы .po"

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Вырезать"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Окна отладки"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Разница Diff"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Правка"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Шаблоны кода ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Редактировать контекстно-зависимую справку"

#: lazarusidestrconsts.lismenueditinstallpkgs
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Установить/удалить пакеты ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr "Редактор меню..."

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Создать подменю"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Удалить шаблон формы..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Удалить элемент"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Обработать событие OnClick"

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Вставить шаблон формы..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Вставить новый пункт (после)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Вставить новый пункт (перед)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Переместить вниз (или направо)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Переместить вверх (или налево)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Новое описание шаблона..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Сохранить как шаблон..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Выбрать меню:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Выбрать шаблон:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Просмотр шаблона"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Заключить выделенное в ..."

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Окру&жение"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Вычислить/Изменить..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Выделить процедуру ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Файл"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Найти"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Найти ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Найти другой конец блока кода"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Найти начало блока кода"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Найти объявление под курсором"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Найти ссылки на идентификатор ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Найти в &файлах ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Найти следующее"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Найти предыдущее"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Параметры ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Перейти по директиве $I"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Перейти к строке ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Исправить несоответствие IFDEF/ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Исправить незаконченный блок"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Справка"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "Внутреннее состояние IDE"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Найти инкрементно"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Увеличить отступ выделенного"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Элемент ChangeLog"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Ключ CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Текущие дата и время"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Общие"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Заметка о GPL"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Заметка о LGPL"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Заметка о модифицированной LGPL"

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Вставить текст"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Текущее имя пользователя"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Просмотреть ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Перейти назад"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Перейти вперёд"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Перейти к"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Перейти к следующей закладке"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Перейти к следующей ошибке"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Перейти к предыдущей закладке"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Перейти к предыдущей ошибке"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Нижний регистр выделенного"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Создать строку ресурсов ..."

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Создать форму"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Создать ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Новый пакет ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Создать проект ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Создать проект из файла ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Создать модуль"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Оперативная справка"

#: lazarusidestrconsts.lismenuopen
#| msgid "Open ..."
msgid "&Open ..."
msgstr "&Открыть ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Открыть имя файла под курсором"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Открыть загруженный пакет ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Открыть файл пакета (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Открыть пакет текущего модуля"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Открыть проект ..."

#: lazarusidestrconsts.lismenuopenrecent
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Открыть &недавнее"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Открыть недавний пакет"

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Открыть недавний проект"

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "П&акет"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Диаграмма пакетов ..."

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "Ссылки на пакеты ..."

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Вставить"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Приостановить"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Список процедур ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "Про&ект"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Инспектор проекта"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Параметры проекта ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Запустить"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Опубликовать проект ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Быстрая компиляция"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Быстрая проверка синтаксиса"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Быстрая проверка синтаксиса прошла успешно."

#: lazarusidestrconsts.lismenuquit
#| msgid "Quit"
msgid "&Quit"
msgstr "В&ыход"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Вернуть"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Убрать из проекта ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Переименовать идентификатор ..."

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Заменить"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "&Заменить ..."

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "Сообщить об ошибке..."

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Пересмотреть каталог исходного кода FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Сбросить отладчик"

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Перезапуск"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Возвратить"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "&Запуск"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Запустить файл"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Параметры запуска ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Запустить до курсора"

#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Сохранить"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Сохранить все"

#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Сохранить &как ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Сохранить проект"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Сохранить проект как ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "П&оиск"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Выделить"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Выделить все"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Выделить блок кода"

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Выделить строку"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Выделить абзац"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Выделить до скобки"

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Выделить слово"

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr "Показать точку исполнения"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Сортировать выделенное ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Шаг со входом"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr "Шаг со входом (контекстно-зависимый)"

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr "Шаг со входом в инструкцию"

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr "Шаг со входом в инструкцию"

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr "Шаг с выходом"

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Шаг в обход"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr "Шаг в обход (контекстно-зависимый)"

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr "Шаг в обход инструкции"

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr "Шаг в обход инструкции"

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Остановить"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "О проекте"

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Закрыть"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Содержание"

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Копировать"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Вырезать"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Стандартное меню Правка"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Стандартное меню Файл"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Стандартное меню Справка"

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Правка"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Выход"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Файл"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Найти"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Найти далее"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Справка"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Создать"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Открыть"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Открыть недавнее"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Вставить"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Вернуть"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Сохранить как"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Учебник"

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "Отменить"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr "Переключить комментарий"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "Се&рвис"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Раскомментировать"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Отменить"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Уменьшить отступ выделенного"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Верхний регистр выделенного"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Вид"

#: lazarusidestrconsts.lismenuviewanchoreditor
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Редактор привязок"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Ассемблер"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Точки останова"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Стек вызовов"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Браузер кода"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"

#: lazarusidestrconsts.lismenuviewcomponentpalette
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Палитра компонентов"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Компоненты"

#: lazarusidestrconsts.lismenuviewdebugevents
#| msgid "Debug events"
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Журнал событий"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Вывод отладчика"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Формы..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Кнопки быстрого доступа IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "История переходов ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Локальные переменные"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Сообщения"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Инспектор объектов"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Регистры"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Браузер ограничений"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Результаты поиска"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "&Просмотреть исходный код проекта"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Редактор исходного кода"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Список ToDo"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Переключить форму/модуль"

#: lazarusidestrconsts.lismenuviewunitdependencies
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Зависимости модулей"

#: lazarusidestrconsts.lismenuviewunitinfo
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Сведения о модуле"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Модули..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Окно наблюдений"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Ок&но"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "Сообщение не содержит информации о позиции в файле:%s%s"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Редактор сообщений"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Класс метода не найден"

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Отсутствующие события"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Отсутствующие идентификаторы"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Отсутствующие пакеты"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Вы можете:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Закомментировать"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Только для Delphi"

#: lazarusidestrconsts.lismissingunitsinfo1
#| msgid "1) Comment out the missing units (ignore them)."
msgid "1) Comment out the selected units."
msgstr "1) Закомментировать выбранные модули."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Использовать модули только для Delphi."

#: lazarusidestrconsts.lismissingunitsinfo2
#| msgid "2) Select a unit path which will be added to project settings."
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Найти модули. Обнаруженные пути добавить в проект."

#: lazarusidestrconsts.lismissingunitsinfo3
#| msgid "3) Abort now, fix the unit path or install packages and try again."
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Прерваться, установить пакеты либо исправить пути, и попытаться снова."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Найти путь к модулю"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Изменить"

#: lazarusidestrconsts.lismore
msgid "More"
msgstr "Больше"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Переместить \"%s\" на позицию вниз"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Переместить \"%s\" на позицию вверх"

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "Переместить страницу"

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(мс)"

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Сохранить сообщения в файл (*.txt)"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Конфликт имён"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Имя новой процедуры"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Никогда"

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "новый"

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Новые Предки"

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "Новый режим сборки"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Новый Класс"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Новое консольное приложение"

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
#| msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "Создать новое приложение CGI.%sИсходный код приложения поддерживается Lazarus."

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Создать программу."

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Создать новый файл редактора.%s Выберите тип."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Создать новый пустой текстовый файл."

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Создать новое графическое приложение.%sИсходный код приложения поддерживается Lazarus."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Создать модуль Паскаля."

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Создать новую программу.%sИсходный код программы поддерживается Lazarus."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Создать проект.%sВыберите тип."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Создать стандартный пакет%sПакет - это набор модулей и компонентов."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Создать модуль с модулем данных."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "Создать новый модуль с фреймом."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Создать модуль с формой LCL."

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "Унаследовать от существующего компонента."

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не выделено элементов"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Выберите сначала элемент"

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Новая кодировка:"

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr "Новая группа - набор режимов"

#: lazarusidestrconsts.lisnewproject
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "(новый проект)"

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "Новый параметр"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr "Новые модули добавляются в выражения uses:"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Нет"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Без файлов резервных копий"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Профилей сборки не выбрано."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Без изменений"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Не выбрано кода"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не унаследовано параметров компилятора."

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr "Ошибок нет"

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "подсказок нет"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Окно IDE не выбрано"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Файл LFM отсутствует"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Макрос не выбран"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "без имени"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sнет"

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "нет"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "нет, щёлкните для выбора"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "элементов не выбрано"

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "Файл Паскаля отсутствует"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Файл программы %s%s%s не найден."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не найдено секции ResourceString"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Обычно фильтр - это регулярное выражение. В простом синтаксисе . означает обычный символ, * - любую последовательность, ? - любой одиночный символ, а запятая и точка с запятой являются разделителями. Например: *.pas;*.pp соответствует ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Не найдено строковой константы"

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Файл не является проектом Delphi"

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Файл не является модулем Delphi"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Пакет не является устанавливаемым"

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "Неверный идентификатор Паскаля"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода FreePascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода Lazarus"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Не реализовано"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Ещё не реализовано:%s%s"

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Еще не реализовано."

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Не сейчас"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Создать"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Создать новый проект"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Выберите тип проекта"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Количество преобразуемых файлов: %s"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - по умолчанию"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "путь объекта"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Переключаться на вкладку 'Избранное' инспектора объектов"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Переключаться на вкладку 'Избранное' инспектора объектов после запроса имени компонента"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Выкл.)"

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Добавить свойства в избранное"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Выберите базовый класс для избранного свойства %s%s%s."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Класс %s%s%s не найден."

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Удалить из избранных свойств"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "автоустановить динамически"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "автоустановить статически"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Описание: "

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sОписание: %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Имя файла: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "установлен динамически"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "установлен статически"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "отсутствует"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "изменён"

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Не выбрано пакетов"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Открыть загруженный пакет"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Имя пакета"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Выберите пакет"

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Выберите пакет, чтобы открыть"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "только чтение"

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Состояние"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sЭтот пакет установлен, но файл lpk не найден"

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sЭтот пакет был создан автоматически"

#: lazarusidestrconsts.lisok
#| msgid "&Ok"
msgid "&OK"
msgstr "&ОК"

#: lazarusidestrconsts.lisold
msgid "old"
msgstr "старый"

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Старые предки"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Старый класс"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Вкл.)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "При разрыве строки (то есть при нажатии клавиши 'Ввод')"

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Поиск только целых слов"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "При вставке из буфера обмена"

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr "Открыть ..."

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Открыть как файл XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Открывать редактор форм при открытии модуля"

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Открыть существующий файл"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Открыть файл"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "Открыть файл"

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Открыть %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Открыть пакет?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Открыть пакет %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Открыть файл пакета"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Открыть проект?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Открыть проект"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Открыть проект снова"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Открыть проект"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Открыть символическую ссылку"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Открыть цель ссылки"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Открыть файл как обычный исходный код"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Открыть пакет %s?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Открыть проект %s?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "или"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Переопределить язык. Например, --language=de. Возможные значения смотрите в каталоге languages."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sпереопределить компилятор по умолчанию, например, ppc386 ppcx64 ppcppc и т. д. Значение по умолчанию хранится в environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr "%sпереопределить режим сборки проекта."

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sпереопределить целевое семейство процессоров проекта, например, i386 x86_64 powerpc powerpc_64 и т. д. Значение по умолчанию: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sпереопределить операционную систему проекта, например, win32 linux. Значение по умолчанию: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sпереопределить библиотеку виджетов проекта, например, gtk gtk2 qt win32 carbon. Значение по умолчанию: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Перезаписать файл?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Перезаписать файл на диске"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' уже используется классами TReader/TWriter. Выберите другое имя."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Пакет"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "пакет %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Информация о пакете"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Имя пакета начинается с ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Имя пакета содержит ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Пакет требует установки"

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Пакеты для установки в IDE"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "модуль пакета"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", обработано "

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Исходный код Паскаля"

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Модуль Паскаля"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Число проходов"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Вставить из буфера обмена"

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Вставить текст из буфера обмена."

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Путь"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Обзор"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Переместить вниз"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Переместить вверх"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Шаблоны пути"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Пути поиска"

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Выбрать каталог"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Путь к утилите Make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Путь к необработанному экземпляру:"

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Добавить элемент"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "Добавить к проекту"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Применить"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Вызвать процедуру %sRegister%s выбранного модуля"

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Очистить выбранное имя файла зависимости"

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Компилировать"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Собрать всё?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Собрать пакет"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Параметры компилятора для пакета %s"

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Параметры компилятора"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Создать Makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, по умолчанию: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Свойства зависимости"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Изменить общие параметры"

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Изменить параметры компиляции пакета"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Свойства файла"

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Общие параметры"

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Справка"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Установить"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Установить пакет в IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неверная максимальная версия"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неверная минимальная версия"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Максимальная версия:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Минимальная версия:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Изменён: %s"

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Прочие..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Переместить зависимость вниз"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Переместить зависимость вверх"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Пакет %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Пакет %s%s%s изменён.%sСохранить пакет?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "пакет %s не сохранён"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Страница: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Обновить зависимость"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Обновить файл"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Только чтение: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Пересобрать всё требуемое"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Очистить и пересобрать"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпилировать"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зарегистрированные дополнения"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Зарегистрировать модуль"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Удалить зависимость"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Удалить зависимость?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить зависимость %s%s%s%sиз пакета %s%s%s?"

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Удалённые файлы (эти элементы не сохранятся в lpk-файле)"

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Удалены требуемые пакеты (они не сохранятся в lpk-файле)"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Удалить файл"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Удалить файл?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Удалить файл %s%s%s%s из пакета %s%s%s?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Удалить выбранный элемент"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Требуемые пакеты"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Сохранить пакет"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Сохранить как имя файла по умолчанию для этой зависимости"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Сохранить как предпочтительное имя файла для этой зависимости"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Максимальная версия %s%s%s пакета некорректна.%s(корректный пример - 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Минимальная версия %s%s%s пакета некорректна.%s(корректный пример - 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Удалить"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Показать исходный код пакета"

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Автосоздан"

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Установлен"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Установить при след. запуске"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Выбранный пакет нужен для:"

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Загруженные пакеты:"

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Пакет %s не найден"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sСостояние: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Удалить при след. пуске"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Добавление параметров к зависимым пакетам и проектам"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Добавление путей к зависимым пакетам и проектам"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Автор"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Автоматически увеличивать версию при сборке"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Автоматически пересобирать по необходимости"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Автоматически пересобирать при пересборке всех"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Пользовательские"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Описание или аннотация"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Времени разработки и выполнения"

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Только времени разработки"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Встраивание в IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Включаемый"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неверный тип пакета"

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "Путь к файлам FPDoc"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Библиотека"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Лицензия"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Компоновщик"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Старшая"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ручная компиляция (не автоматически)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Младшая"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Объект"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Параметры пакета"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Тип пакета"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Возможности"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Релиз"

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Только времени выполнения"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Пакет %s%s%s имеет метку Автоинсталляция.%sЭто значит, что он автоматически встроится в IDE. Устанавливаемые пакеты%sдолжны быть для разработки."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Этот пакет предоставляет те же возможности, что и следующие пакеты"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Обновление и пересборка"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Использование"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Прервать"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Ход операции"

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля должен иметь расширение .pp или .pas"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Найден конфликт"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Редактировать виртуальный модуль"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Имя файла:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Исправить регистр файлов"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Неверное имя файла модуля"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Неверное имя модуля"

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Переместить файл вниз"

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Переместить файл вверх"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "Сортировать файлы"

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Модуль с таким именем уже существует.%sФайл: %s"

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Имя модуля не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Имя модуля используется при раскрытии IDE выражений uses"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Имя модуля:"

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Имена модуля и файла не совпадают.%sПример: unit1.pas и Unit1"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "добавление CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Каталог вывода"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Метка каталога исходного кода пакета"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Путь модуля"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Вы действительно хотите сбросить все изменения в пакете %s и загрузить его из файла?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новый модуль не в пути поиска"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опубликовать пакет"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Возвратить пакет?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Файл %s%s%s%sсейчас не находится в списке путей модулей пакета.%s%sДобавить его туда?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Контекстная справка ещё не реализована"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Правый щелчок на элементе дерева даст меню со всеми доступными функциями пакета."

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Во всплывающем меню больше функций"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Двоичный"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Включаемый файл"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Файл XML нюансов"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - текст формы Lazarus"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - ресурс Lazarus"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Главный модуль"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Текстовый"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Виртуальный модуль"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sДобавление новой зависимости пакета %s: пакет %s%s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sДобавление новой зависимости проекта %s: пакет %s%s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Добавить модуль в выражение uses пакета. Отключить это только для модулей, которые не должны компилироваться во всех случаях."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Найдены модули с с дублирующимися именами"

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Требуемый пакет не найден. Смотрите диаграмму пакетов."

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автоустановленные пакеты"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОба пакета связаны. Это значит, что либо один из них использует другой, либо оба они используются третьим пакетом."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Нарушенная зависимость"

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Циклическая зависимость пакетов"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Компиляция пакета %s"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Удаление не удалось"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Удалить старый файл пакета?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Удалить старый файл пакета %s%s%s?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Зависимость без владельца:%s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Ошибка чтения файла"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Ошибка чтения пакета"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Ошибка: обновление файлов PO для пакета %s не удалось"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Ошибка записи файла"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Ошибка записи пакета"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл уже есть в пакете"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл в проекте"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Имя файла отличается от имени пакета"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Имя файла использовано другим пакетом"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Имя файла использовано проектом"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Файл %s%s%s не найден."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не сохранён"

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Игнорировать и немедленно сохранить пакет."

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "При установке пакета %s автоматически установится пакет:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "При установке пакета %s автоматически установятся эти пакеты:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "неверное имя файла компилятора"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неверное расширение файла"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неверное расширение файла пакета"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неверное имя файла пакета"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неверное имя пакета"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неверное имя пакета"

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Загрузка пакета %s заменит пакет %s%sиз файла %s.%sСтарый пакет изменён. Сохранить старый пакет %s?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NewPackage"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Пакет: %s"

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Пакет %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфликты пакетов"

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Файл пакета отсутствует"

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Файл пакета не сохранён"

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Пакет %s%s%s не имеет правильного каталога вывода:%s%s%s%s"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Пакет не является пакетом времени разработки"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Требуется пакет"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "главный файл исходного кода пакета"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Имя пакета уже занято"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакеты должны иметь расширение .lpk"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Сохраните файл перед добавлением в пакет."

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Сначала сохраните пакет."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Проект: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Пересобрать Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Переименовать файл в пакете?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Переименовать файл в нижний регистр?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Заменить существующий файл %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Заменить файл"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Сохранить пакет?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Сохранить пакет %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Должен ли файл быть переименован в нижн. рег. в %s%s%s%s?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Пропустить это сообщение"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "файл настроек статических пакетов"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Файл компилятора для пакета %s не является исполнимым:%s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Файл %s%s%s%sуже в пакете %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Файл %s%s%s не является пакетом Lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Имя файла %s%s%s не соответствует имени пакета %s%s%s в файле.%sСменить имя пакета на %s%s%s?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Файл с именем %s%s%s имеется в текущем проекте.%sПроекты и пакеты не должны иметь общих файлов."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Имя файла %s%s%sиспользуется%sпакетом %s%s%s%sв файле %s%s%s."

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Файл %s%s%s%sпакета %s отсутствует."

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Сначала необходимо сохранить файл %s%s%s%sпакета %s."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Следующий пакет не был загружен:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Следующие пакеты не были загружены:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sСледующие модули будут добавлены в выражение uses %s%s:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Пакет %s%s%s не откомпилировался. %sУдалить его из списка на установку?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Имя пакета %s%s%s в%s%s%s%s не является корректным именем пакета Lazarus."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Пакет %s является пакетом времени выполнения.%sТакие пакеты не могут встраиваться в IDE."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакет %s%s%s отмечен на установку, но не найден.%sУдалить зависимость из списка установки пакетов?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Пакет %s требуется для %s, который помечен на установку.%sСмотрите диаграмму пакетов."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Имя пакета %s%s%s некорректно.%sВыберите другой пакет (например, package1.lpk)."

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Имя пакета %s%s%s %sфайла %s%s%s некорректно."

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Пакет %s имеет файл%s%s%s%s.%sДолжен ли файл быть переименован, как и пакет?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr " Был отмечен пакет %s%s%s.%sСейчас Lazarus поддерживает только статически скомпонованные пакеты. Действительное удаление требует пересборки и перезапуска Lazarus.%s%sВы хотите пересобрать Lazarus сейчас?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Пакет %s%s%s был помечен для установки.%sСейчас Lazarus поддерживает только статически скомпонованные пакеты. Действительная установка требует пересборки и перезапуска Lazarus.%s%sВы хотите пересобрать Lazarus сейчас?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект требует пакет %s%s%s.%sОн не найден. Смотрите Проект -> Инспектор проекта."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Есть два модуля с одинаковым именем:%s%s1. %s%s%s из %s%s2. %s%s%s из %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Обнаружен цикл зависимостей пакетов. Смотрите диаграмму пакетов."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Есть модуль FPC с таким же именем, как и пакет:%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Есть модуль FPC с таким же именем, как:%s%s%s%s%s из %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Уже есть другой пакет с именем %s%s%s.%sКонфликтующий пакет:%s%s%s%sФайл: %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Уже имеется загруженный пакет %s%s%s %sиз файла %s%s%s.%sСмотрите Компоненты -> Диаграмма пакетов.%sЗамена невозможна."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Среди требуемых пакетов есть несохранённый. Смотрите диаграмму пакетов."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Есть модуль с тем же именем, что и пакет: %s%s1. %s%s%s из %s%s2. %s%s%s%s"

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Это виртуальный пакет. Он ещё не имеет исходного кода. Сначала сохраните пакет."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Невозможно создать каталог"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Невозможно создать каталог вывода %s%s%s%sдля пакета %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Невозможно создать каталог исходного кода пакета %s%s%s%sдля пакета %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Невозможно создать целевой каталог для lazarus:%s%s%s%s.%sЭтот каталог нужен для вновь изменённой IDE Lazarus с вашими пакетами."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Невозможно удалить файл %s%s%s."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Невозможно удалить файл"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Невозможно удалить старый файл состояния %s%s%s%sдля пакета %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Невозможно загрузить пакет"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Невозможно открыть пакет %s%s%s.%sЭтот пакет был отмечен для установки."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Невозможно прочитать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Невозможно записать пакет %s%s%s%sв файл %s%s%s.%sОшибка: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Невозможно записать файл состояния %s%s%s%sпакета %s.%sОшибка: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Удалить пакет?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Удалить пакет %s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Несохранённый пакет"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Использовать модуль"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Внимание: Файл %s%s%s%sпринадлежит текущему проекту."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "Регистрация пакетов"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Невозможно зарегистрировать компоненты без модуля"

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - средства и функции для разбора, просмотра и редактирования исходного кода на Паскале"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Класс компонента %s%s%s уже определён"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sИмя файла: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Неверный класс компонента"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Неверное имя модуля: %s"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Файл пакета не найден"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Процедура регистрации пуста"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "Был вызван RegisterUnit, но пакетов не зарегистрировано."

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Ошибка регистрации"

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - компонент редактора, используемый Lazarus. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - библиотека компонентов FreePascal - обеспечивает базовые классы для Объектного Паскаля."

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - библиотека компонентов Lazarus - содержит все основные компоненты для редактирования форм."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Пакет %s%s%s установлен, но не был найден корректный файл пакета (.lpk).%sБыл создан неработающий пакет-пустышка."

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - библиотека времени выполнения (Run-Time Library) - является основой всех программ FreePascal."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Это пакет по умолчанию. Используется только для компонентов без пакета. Такие компоненты устарели."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Пакет установлен, но файл lpk не найден. Все компоненты отключены. Исправьте эту ошибку."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sИмя модуля: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Модуль не найден: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Модуль %s%s%s был удалён из пакета"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Этот файл отсутствует во всех загруженных пакетах."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Невозможно прочитать файл пакета %s%s%s.%sОшибка: %s"

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Имеется"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Глобальные"

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Только существующие файлы"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Ссылки на пакеты"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Показывать глобальные ссылки"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Показывать пользовательские ссылки"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Пользовательские"

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Откройте модуль перед запуском."

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "Сначала выберите режим сборки."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Выделите некоторый код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Все>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Сменить шрифт"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Копировать имя метода в буфер обмена"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Фильтровать по любой части метода"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Фильтровать по началу метода"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Перейти к выбранному"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Нет>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Объекты"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Список процедур"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Тип"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Выбрать каталог файлов .po"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Не сохранять информацию о сеансе работы"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Указатель"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Сохранять в каталоге настроек IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Сохранять в файле .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Сохранять в файле .lps в каталоге проекта"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Сохранять информацию о сеансе работы в"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Предыдущее слово"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "первичный каталог настроек, где Lazarus хранит свои файлы настроек. По умолчанию - "

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Печать"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Скрытый метод"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Вероятно, вам следует установить некоторые пакеты перед продолжением.%s%sВнимание:%sПроект зависит от пакетов времени разработки, которые могут понадобиться для открытия форм в дизайнере. При продолжении вы можете получить ошибки об отсутствующих компонентах, и загрузка формы, возможно, приведёт к очень неприятным результатам.%s%sРекомендуется прервать процесс и установить сначала эти пакеты.%s%s"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Процедура"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура с интерфейсом"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Программа"

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Программа%sПрограмма Free Pascal. Исходный код программы автоматически поддерживается Lazarus."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Обнаружена программа"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Исходный код программы должен иметь расширение Паскаля, например, .pas, .pp или .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr "Добавить файлы в проект"

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Добавить файл к проекту"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Зависимость уже есть"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Добавить файлы редактора"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Добавить файлы"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неверные версии (минимальная/максимальная)"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Неверное имя пакета"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Неверное имя модуля Паскаля"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неверная версия"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Макс. версия (по выбору):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Миним. версия (по выбору):"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Новая зависимость"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Имя пакета:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакет не найден"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Зависимость %s%s%s не найдена.%sВыберите существующий пакет."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Максимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Минимальная версия %s%s%s некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Имя пакета %s%s%s некорректно.%sВыберите существующий пакет."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Проект уже зависит от пакета %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже имеется в проекте%sв файле: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Имя модуля %s%s%s уже имеется в выделенном%sв файле: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Имя модуля %s%s%s не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Добавить к проекту"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Имя модуля уже существует"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Проект изменен"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Проект изменён на диске"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Имя каталога проекта"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Отображать в заголовке в панели задач также путь к каталогу проекта"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Имя файла проекта"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Пути включений проекта"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Обнаружен файл сведений проекта"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Информация о проекте"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект является запускаемым"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Свойства макросов проекта"

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "макрос ProjectUnitPath"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Каталог вывода проекта (например, каталог с ppu)"

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "Каталог проекта:"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Каталог, в котором располагается главный файл проекта"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Проект %s вызвал класс исключения '%s'."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Проект %s вызвал класс исключения '%s' с сообщением:%s%s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Путь к исходному коду проекта"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Проект %s%s%s успешно собран"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "модуль проекта"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Путь к модулям проекта"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Мастер создания проекта"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Подтвердите удаление зависимости"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Подтвердите удаление файла"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Удалить зависимость для %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Инспектор проекта - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Удалены требуемые пакеты"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Удалить файл %s из проекта?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Невозможно прочитать файл состояния %s проекта %s%sОшибка: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Невозможно записать файл состояния для проекта %s%sОшибка: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Собирать всегда (даже при отсутствии изменений)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Ошибка"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Невозможно изменить список автосоздаваемых форм в исходном коде программы.%sИсправьте сначала ошибки."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Метка каталога с исходным кодом проекта"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Подсказка по значению"

#: lazarusidestrconsts.lisproperties
#| msgid "Properties (replace or delete)"
msgid "Properties (replace or remove)"
msgstr "Свойства (заменять или удалять)"

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "Свойства параметра режима сборки"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Защищённый метод"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Общий метод"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Опубликованный метод"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Каталог публикации проекта"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Неверный фильтр исключений"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Неверный фильтр включений"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Сохранять файлы .lrs в каталоге вывода"

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля должен иметь расширение .pp или .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Редактировать виртуальный модуль"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Модуль с таким именем уже существует. %sФайл: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Имя модуля не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Имя модуля используется при раскрытии IDE выражений uses"

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Имена модуля и файла не совпадают.%sПример: unit1.pas и Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Преобразовать проект Delphi"

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Новый проект"

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Открыть проект"

#: lazarusidestrconsts.lispwopenrecentproject
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Открыть недавний проект"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Создать локальную переменную"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Быстрые исправления"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Быстрое исправление: удалить модуль"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Найти идентификатор"

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Выход из Lazarus"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Ошибка чтения"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Запись/Структура"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Регистры"

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Имя"

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Регулярное выражение"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Относительные пути"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "удалить"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Удалить все некорректные свойства"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Удалить все модули"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Удалить из списка на установку"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Удалить из проекта"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Удалить из путей поиска"

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Удалить локальную переменную %s"

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Удалить локальную переменную"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr "Удалить несуществующие файлы"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Удалить выбранные модули"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Удалить их"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Удалить пути из списка \"Другие модули\""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Удалить модуль из выражения Uses"

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Переименовать файл?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не удалось переименовать файл"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Переименовать в %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Преобразовать в нижний регистр"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Переоткрыть проект"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Открыть с другой кодировкой"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Число повторов:"

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Замена"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Функции замены"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Замены"

#: lazarusidestrconsts.lisreplaceremoveunknown
#| msgid "Replace unknown types and properties"
msgid "Fix unknown properties and types"
msgstr "Исправить неизвестные свойства и типы"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Замена выделенного не удалась."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Требует FPC версии 2.4 либо выше. Аналог ресурсов Delphi"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Пересмотреть"

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Ошибка загрузки ресурса"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Ошибка сохранения ресурса"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr "Тип ресурсов проекта:"

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "Ответ: %sПродолжить?"

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "Result :="

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Результат функции:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "Возвратить список всех значений оператора case перед переменной."

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Возвращение не удалось"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Стрелка вправо"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Правая привязка"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Правый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства справа от компонента."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается правая граница. Оставьте пустым для родителя."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Правые края"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Равномерно по правым краям"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Корневой элемент"

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (идёт исполнение ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не является исполнимым"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Главное приложение %s%s%s не является исполнимым файлом."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Запуск до курсора не удался"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Абстрактные методы - ещё не замещены"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Абстрактные методы %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Курсор не находится на объявлении класса"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE занята"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s - абстрактный класс, он имеет %s абстрактных методов."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Абстрактных методов не найдено"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Заместить все выделенные"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Заместить первый выделенный"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Снять выделение"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Имеется %s абстрактных методов, подлежащих замещению.%sВыберите методы, для которых должны быть созданы заглушки:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Абстрактные методы, подлежащие замещению, отсутствуют."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Этот метод не может быть замещён, так как он определён в текущем классе"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Невозможно показать абстрактные методы текущего класса, так как"

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Сохранить ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Сохранить все сообщения в файл"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "сохранить все измененные файлы"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Сохранить и выйти из диалога"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Сохранить и перезапустить IDE"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Сохранить изменения?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Сохранить изменения в проект %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "сохранить текущий файл редактора"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Сохранять информацию редактора для файлов, не принадлежащих проекту"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Сохранить файл как"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Сохранить файл %s%s%sперед закрытием формы %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Сохранять информацию о файлах, закрытых в редакторе"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Сохранить проект %s (*%s)"

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Сохранить параметры"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Сохранить "

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Масштабный фактор:"

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Искать "

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Поиск модуля"

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "вторичный каталог настроек, где Lazarus ищет шаблоны файлов настроек. По умолчанию - "

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Смотрите сообщения."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sСмотрите Проект -> Инспектор проекта"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Искать элемент справки:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Выберите элемент"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Выберите файлы форм Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Выбор"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(выбран сосед снизу)"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(выбран сосед слева)"

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(выбран сосед справа)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(выбран сосед сверху)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Выберите файл"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Выбор превышает строковую константу"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Средство выбора"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "Выбрать текущий режим сборки"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Установить по умолчанию"

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr "Установка значений макросов"

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(Настроить отступ по умолчанию)"

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "Установить значение"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Краткое:"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Показать"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Выводить подсказки с объявлениями"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Показать разницу между режимами ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Показывать пустые модули/пакеты"

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Показывать значки для:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Показывать поле (лев)"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Показывать всплывающие подсказки в инспекторе объектов"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Показывать идентификаторы"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Показывать информационную панель"

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Показать старый порядок перехода"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Показывать пакеты"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Показывать специальные символы"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Показывать строку состояния"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Показывать модули"

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Выводить подсказки со значениями во время отладки"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "показать версию и выйти"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Сжать до наименьшего"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Сосед"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Простой синтаксис"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Пропустить файл"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Пропустить файл и продолжить загрузку"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Пропустить загрузку предыдущего проекта"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "Приоритет размера над скоростью"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Совпадения"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Извините, пока не реализовано"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Извините, этот тип ещё не реализован"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "По возрастанию"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Отмена"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Учитывать регистр"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "По убыванию"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Сортируемые объекты"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Игнорировать пробелы"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Строки"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Параметры"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзацы"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Предпросмотр"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Принять"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Сортировать выделенное"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Слова"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Источник и назначение одинаковы:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "&Точка останова в исходном коде"

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Исходный каталог %s%s%s%sи каталог назначения %s%s%s%sсовпадают.%s%sВозможно, вы не поняли смысл функции.%sОна очистит/пересоздаст каталог назначения%sи скопирует в него пакет/проект."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Каталог исходного кода %s%s%s не существует."

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Исходный код изменён"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Исходный код  на странице %s%s%s изменён. Сохранить?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "Исходный код был изменён в нескольких вкладках. Сохранить содержимое вкладки %s%s%s? (осталось %d)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Пути к исходному коду"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Равномерно"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Исходная ОС"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Поиск"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Поиск текста"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Начать преобразование"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Начать новый проект"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Остановить текущую отладку и пересобрать проект?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Останов при исключении"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Остановить отладку?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Странный файл LPI"

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Ошибка потока"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Ошибка потоков"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Строка"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Стиль"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Подпроцедура"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Подпроцедура того же уровня"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Успешно"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Подозрительный путь поиска включаемых файлов"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Подозрительный путь поиска модулей"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Ревизия SVN: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неверное имя переменной"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s не является корректным идентификатором."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Перекрыть системную переменную"

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Режим синтаксиса"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Таб"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Порядок перехода"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Семейство процессоров:"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
#| msgid "Target file name: (empty = use unit output directory)"
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Имя исполнимого файла: (-o, пустое = использовать каталог вывода модулей)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Имя исполнимого файла (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Имя исполнимого файла проекта"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Имя исполнимого файла с параметрами"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Операционная система"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Внутренняя ошибка компилятора! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Редактируемое поле"

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""
"Вставить редактируемое поле со значением по умолчанию:\n"
"\"\",Sync=n (,S=n) для синхронизации с предыдущим полем (n может принимать значения от 1 до наибольшего номера предыдущего поля);\n"
"\"default\",Sync, для синхронизации с предыдущим полем с таким же значением 'default'.\n"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Каталог проб"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Application Bundle для \"%s\" успешно создан"

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr "Макрос сборки \"%s\" не начинается с \"%s\"."

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Класс %s%s%s имеет тип TControl, и может быть вставлен только в управляющий элемент.%sНевозможно вставить."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "Средством CodeTools найдена ошибка:%s%s%s"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Команда после %s%s%s"

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Команда после опубликования некорректна:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Компонент %s не может быть удалён, так как %s им не владеет."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%s вызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Редактор компонента для класса %s%s%s,%sсвязанный со словом #%s %s%s%s,%sвызвал ошибку:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Компонент %s унаследован от %s.%sДля удаления унаследованного компонента следует открыть объект-предок и удалить его там."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Компонент %s унаследован от %s.%sДля переименования унаследованного компонента откройте его родителя и выполните переименование там."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr "Имена компонентов должны быть уникальными в пределах формы/модуля данных. Сравнение имён, как и для обычных идентификаторов Паскаля, происходит без учёта регистра."

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий компилятор %s%s%s.%sне является исполнимым файлом.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%sили же проверьте Окружение-> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Текущий компилятор %s%s%s%s не является исполнимым файлом.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходного кода FreePascal %s%s%s%sне выглядит корректно.%sВыберите ОК чтобы вернуть используемый по умолчанию %s%s%s,%s или же проверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог исходного кода FreePascal %s%s%s%sне выглядит корректно.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sне выглядит корректно.%sБез него Вы не сможете создавать приложения LCL.%sВыберите ОК для использования каталога по умолчанию %s%s%s,%s или же проверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Текущий каталог Lazarus %s%s%s%sне выглядит корректно.%sБез него Вы не сможете создавать приложения LCL.%sПроверьте Окружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Текущий путь модуля для файла %s%s%s%s - %s%s%s%s.%s%sПуть к модулям LCL %s%s%s отсутствует.%s%sПодсказка для новичков:%sСоздайте приложение Lazarus и поместите файл в каталог проекта."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Отладчик %s%s%s%s не существует или не является исполнимым файлом.%s%sСмотрите Окружение -> Параметры отладчика"

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Каталог назначения%s%s%s%s не существует."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Каталог назначения %s%s%s не существует.%sПроверьте имя исполнимого файла в меню Проект -> Параметры проекта."

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Присутствие каталога %s%s%s в списке путей к модулям больше не требуется.%sУдалить его?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "Каталог %s%s%s недоступен для записи."

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Каталог %s%s%s отсутствует в списке путей к модулям.%sДобавить его?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Каталог %s не найден."

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Файл %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Файл %s не выглядит, как файл LPI."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Индекс файлов требуется для обеспечения работы функции поиска и ей подобных. Во время просмотра можно редактировать исходный код и компилировать, но функция поиска и ей подобные будут сообщать, что требуемые модули не найдены. Процесс может занять некоторое время."

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Файл %s%s%s является символической ссылкой.%s%sОткрыть %s%s%s вместо него?"

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Файл %s%s%s не является проектом Delphi (.dpr)"

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Файл %s%s%s не является модулем Delphi."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "Файл %s%s%s не является проектом Lazarus.%sСоздать новый проект для этого %s?"

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл %s%s%s%sвыглядит как программа. Закрыть текущий проект и создать новый проект Lazarus для этой программы?%s\"Нет\" откроет файл как обычный исходный код."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Файл %s, вероятно, является файлом программы уже существующего проекта Lazarus."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Файл %s%s%s%sнайден в одном из каталогов исходного кода пакета %s, и он выглядит как откомпилированный модуль. Такие модули должны быть в каталоге вывода пакета, иначе другие пакеты не смогут правильно использовать пакет.%s%sУдалить такие файлы?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Файл %s%s%s%sне найден.%sВы хотите поискать его самостоятельно?%s"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Файл %s%s%s%sне найден.%sПропуск продолжит загрузку проекта,%sПрервать - остановит загрузку."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "Первый режим сборки является режимом сборки по умолчанию и должен храниться в проекте, а не в сессии."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "Первый режим сборки является режимом сборки по умолчанию и должен храниться в проекте, а не в сессии."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Следующие методы, используемые %s, отсутствуют в исходном коде%s%s%s%s%s%sУдалить некорректные ссылки?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Компилятор FreePascal (имя файла: %s) не найден.%sВам рекомендуется установить fpc"

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Каталог исходного кода FreePascal не найден.%sОтдельные действия с кодом не будут работать.%sРекомендуется установить его и установить путь%sОкружение -> Параметры окружения -> Файлы"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr "Отладчик GNU через SSH позволяет проводить отладку удалённо через соединение SSH. Обратитесь к файлу docs/RemoteDebugging.txt за подробностями. Путь должен содержать имя файла клиента SSH, имя удалённой машины с (необязательным) именем пользователя и имя файла GDB на удалённой машине. Например: %s/usr/bin/ssh username@hostname gdb%s или: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Идентификатор является модулем. Для его переименования используйте функцию Файл -> Сохранить как."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Клавиша %s%sуже назначена для %s.%s%sУдалить старую ассоциацию и назначить клавишу для новой функции%s%s?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Требуемый для исполнения Application Bundle %s%sне существует либо не является исполнимым файлом.%sВы хотите создать его?%s%sДля настройки смотрите Проект -> Параметры проекта -> Приложение."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Запускающее приложение %s%s%s%не существует или не является исполнимым файлом.%s%sСмотрите Запуск -> Параметры запуска... -> Локальные"

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Каталог Lazarus не найден.%sВы не сможете создавать приложения LCL.Проверьте Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "LFM-файл (файл формы Lazarus) содержит некорректные свойства. Это значит, например, что он содержит некоторые свойства/классы, которых нет в текущей версии LCL. Обычно следует убрать эти свойства из lfm и (если надо) исправить код Паскаля вручную."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Имя %s%s%s не является корректным идентификатором Паскаля."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Путь к новому включаемому файлу отсутствует в списке путей поиска включаемых файлов.%sДобавить каталог %s?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Новый модуль ещё не находится в путях поиска.%sДобавить каталог %s?"

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "Список путей \"Другие исходные коды\" содержит путь, уже имеющийся в списке \"Другие модули\".%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Каталог вывода %s%s%s отсутствует."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска включаемых файлов %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска включаемых файлов %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска модулей %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска модулей %s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Каталог вывода должен быть отдельным и не содержать файлов исходного кода."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Это имя уже имеет класс-владелец"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Это имя уже имеет владелец"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакет %s добавляет путь \"%s\" к списку путей к включаемым файлам IDE.%sВероятно, это ошибка конфигурации пакета."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакет %s добавляет путь \"%s\" к списку путей к модулям IDE.%sВероятно, это ошибка конфигурации пакета."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Пакет уже содержит модуль с таким именем."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Пакет %s не может быть удалён, так как требуется самой IDE."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Пакет %s не имеет процедуры \"Register\". Обычно это означает, что он не предоставляет расширений IDE. Его установка, вероятно, только увеличит размер IDE, и даже может вызвать её нестабильную работу.%s%sПодсказка: Если вы хотите использовать пакет в вашем проекте, используйте пункт меню \"Добавить к проекту\"."

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Программа %smake%s не найдена.%sЭто средство нужно, чтобы собрать Lazarus.%s"

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Параметры компилятора для проекта не соответствуют директивам в главном файле исходного кода. В новом модуле будут использованы режим синтаксиса и тип строк в соответствии с параметрами проекта:"

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr "Проект не использует модуль LCL Interfaces, но, вероятно, требует его.%sКомпоновщик будет выдавать непонятные ошибки, если формы LCL будут использоваться без модуля Interfaces."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Проект не имеет главного файла исходного кода."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Файл сведений проекта %s%s%s%sсовпадает с главным файлом исходного кода!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Файл информации о проекте %s%s%s%sизменён на диске."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект требуется сохранить до компиляции%sВыбор каталога для сборки пробных проектов в параметрах окружения%sпозволит создавать новые проекты и сразу собирать их.%sСохранить проект?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Проект использует целевую ОС %s и процессор %s.%sSystem.ppu для этой цели не был найден в каталогах двоичных файлов FPC. %sУбедитесь в том, что FPC установлен корректно для данной цели, и что в файл fpc.cfg вписаны верные каталоги."

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Проект использует новые ресурсы FPC, требующие FPC версии 2.4 либо выше"

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В каталоге есть и другие файлы с таким же именем,%sотличающиеся только регистром:%s%s%sУдалить их?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "На диске есть файл с таким же именем и похожим расширением%sФайл: %s%sФайл с дублирующимся именем: %s%s%sУдалить второй файл?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr "Макрос сборки с именем %s%s%s уже существует."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Компонент с таким именем уже имеется"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Форма с именем %s%s%s уже имеется"

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Макрос IDE с именем \"%s\" уже имеется"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Модуль с именем %s%s%s уже имеется. Идентификаторы Паскаля должны быть уникальны."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "В проекте модуль с именем %s%s%s уже имеется.%sВыберите другое имя"

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Должен иметься хотя бы один режим сборки."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Ресурсный класс %s%s%s унаследован от %s%s%s. Возможно это опечатка в TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при записи выбранных компонентов %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при преобразовании двоичного потока выбранного компонента %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Произошла ошибка при копировании потока компонента в буфер:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Компонент верхнего уровня не может быть удалён."

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Эти параметры хранятся в проекте."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Эти модули не были найдены:"

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Пробный каталог не найден:%s%s%s%s%s(смотрите параметры окружения)"

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Модуль %s%s%s уже существует.%sПропуск - переименовать файл,%sОтмена - не сохранять этот файл,%sПрервать - не сохранять больше ничего."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Модуль принадлежит пакету %s."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Модуль %s дублируется в путях к модулям %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Это имя уже имеет модуль"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Имя файла %s%s%s модуля не в нижнем регистре.%sКомпилятор FreePascal не проводит поиск для всех вариантов. Рекомендуется использовать имя в нижнем регистре.%s%sПереименовать файл в нижний регистр?"

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Модуль %s используется другими файлами.%sОбновить ссылки автоматически?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Модуль уже называется %s%s%s. Идентификаторы Паскаля должны быть уникальны."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Путь поиска модулей %s%s%s содержит каталог исходного кода %s%s%s пакета %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Рабочий каталог %s%s%s не существует.%sПроверьте его в меню Запуск -> Параметры запуска."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Эта функция требует наличия открытого файла .lfm в редакторе исходного кода."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "это справочное сообщение"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Содержимое этого файла похоже на исходный код на Паскале.%sРекомендуется использовать имена файлов в нижнем регистре во избежание различных проблем на некоторых файловых системах и с другими компиляторами.%sПереименовать в нижний регистр?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Этот проект не имеет главного файла исходного хода"

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Этот набор параметров сборки Lazarus не поддерживается установленным экземпляром.%sКаталог %s%s%s недоступен для записи.%sДругие методы установки смотрите на сайте Lazarus."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Это выражение не может быть извлечено.%sВыберите какой-то код, чтобы извлечь новую процедуру/метод."

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr "Это действие приведёт к появлению цикла привязок."

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "&Автоматически закрывать в случае успеха"

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Компиляция:"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Заголовок"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Заголовок в панели задач имеет следующий вид: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Название (оставьте пустым для значения по умолчанию)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Функция: добавить разделитель путей"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Функция: убрать разделитель путей"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Функция: извлечь расширение файла"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Функция: извлечь имя файла с расширением"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Функция: извлечь только имя файла"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Функция: извлечь путь файла"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(неизвестный макрос: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Путь:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Переключение режимов показа имён файлов с полным или относительным путём"

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr "Для установки следует перекомпилировать и перезапустить IDE"

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Вверх"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Верхняя привязка"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Верхний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства над компонентом."

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Верхние края"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Это сосед, к которому привязывается верхняя граница. Оставьте пустым для родителя."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Равномерно по верхним краям"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Дерево требует обновления"

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Типы (не удаляются, если нет замены)"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Не показывать это сообщение снова."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Ошибка в регулярном выражении"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Шрифт без UTF-8"

#: lazarusidestrconsts.lisuegotoline
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Перейти к строке:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Не найден"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Заменить %s%s%s%s на %s%s%s в этом месте?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Ищу: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Строка поиска '%s' не найдена!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Текущий шрифт редактора не поддерживает UTF-8, но ваша система, вероятно, её использует.%sЭто означает, что символы, не входящие в ASCII, могут отображаться неверно.%sВы можете выбрать другой шрифт в параметрах редактора."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Очистить кэш включаемых файлов"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s байт"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Очистить"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Включён:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "в проекте:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Строк:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Имя:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "нет"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "ОК"

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Пути (только чтение)"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Размер:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Исх"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Тип:"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Модуль"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "да"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Показать значения CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Невозможно преобразовать двоичный поток в текст"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Невозможно скопировать компоненты в буфер обмена"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Невозможно добавить комментарий заголовка ресурса к файлу ресурса %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Невозможно добавить ресурс T%s:FORMDATA к файлу ресурсов %s%s%s%s.%sВозможно, ошибка синтаксиса."

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "Невозможно добавить параметр"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Невозможно добавить %s к проекту, так как в проекте уже есть модуль с таким именем."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Невозможно сохранить резервный файл %s%s%s как %s%s%s!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sНевозможно изменить класс %s на %s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Невозможно очистить каталог назначения"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Невозможно очистить %s%s%s.%sПроверьте права доступа."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Невозможно преобразовать текст компонента в двоичный формат:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Невозможно преобразовать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Невозможно преобразовать lfm в lrs и записать lrs-файл."

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Невозможно преобразовать текстовые данные формы файла %s%s%s%s%sв двоичный поток. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Невозможно скопировать файл"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Невозможно скопировать файл %s%s%s%sв %s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Невозможно скопировать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Невозможно создать резервный каталог %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Невозможно создать каталог %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Невозможно создать каталог %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Невозможно создать файл"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Невозможно создать файл %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Невозможно создать файл%s%s%s%s"

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Невозможно создать файл %s%s%s."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Невозможно создать ссылку %s%s%s с объектом %s%s%s"

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Невозможно создать новый метод. Исправьте ошибки, указанные в окне сообщений."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Невозможно создать временный буфер LFM"

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Удаление невозможно"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Невозможно удалить файл с дублирующимся именем %s%s%s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Невозможно найти секцию ResourceString в этом или любом другом используемом модуле."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Невозможно найти правильное имя класса в %s%s%s"

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Невозможно найти файл %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "Невозможно найти файл %s%s%s.%sЕсли он принадлежит вашему проекту, проверьте пути поиска в%sПроект -> Параметры компилятора -> Пути -> Другие модули. Если он принадлежит пакету, проверьте соответствующие параметры компиляции пакета. Если этот файл принадлежит Lazarus, удостоверьтесь, что компилируете его после очистки. Если файл принадлежит FPC, проверьте fpc.cfg. Если не уверены, вызовите Проект -> Параметры компилятора -> Тест"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Невозможно найти %s в потоке LFM"

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Невозможно найти метод. Исправьте ошибки в окне сообщений."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "Невозможно найти модуль Паскаля (.pas,.pp) для файла .lfm%s%s%s%s"

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Невозможно найти модуль класса компонента %s%s%s."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Невозможно определить изменения в редакторе."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Невозможно получить исходный код для дизайнера."

#: lazarusidestrconsts.lisunabletoloadfile
#| msgid "Unable to load file :%s%s"
msgid "Unable to load file:%s%s"
msgstr "Невозможно загрузить файл:%s%s"

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Невозможно загрузить старый файл ресурсов.%sЭтот файл является первым включаемым в%sсекции initialization.%sНапример, {$I %s.lrs}.%sВозможно, синтаксическая ошибка."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Невозможно загрузить пакет %s%s%s"

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Невозможно загрузить класс компонента %s%s%s, так как он зависит сам от себя."

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Невозможно открыть компонент-предок"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Невозможно открыть дизайнер. %sКласс %s не унаследован от класса, подобного TForm или TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Невозможно прочитать %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Невозможно прочитать файл"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Невозможно прочитать файл %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Невозможно прочитать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Невозможно прочитать файл %s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Невозможно прочитать файл информации о проекте%s%s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Невозможно прочитать файл информации о проекте%s%s%s%s."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Невозможно удалить старый резервный файл %s%s%s!"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Невозможно переименовать файл с дублирующимся именем %s%s%s%sв %s%s%s"

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Невозможно переименовать файл"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Невозможно переименовать файл %s%s%s в %s%s%s!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Невозможно переименовать файл %s%s%s%sв %s%s%s."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Невозможно переименовать форму в исходном коде."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Невозможно переименовать метод. Исправьте ошибку в окне сообщений."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Невозможно переименовать переменную в исходном коде."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Запуск невозможен"

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Невозможно сохранить файл %s%s%s"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Невозможно установить привязку к компоненту"

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Невозможно показать метод. Исправьте ошибку в окне сообщений."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Невозможно вывести выбранные компоненты в поток"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Невозможно вывести выбранные компоненты в поток."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Невозможно вывести в поток %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Невозможно преобразовать двоичный поток компонентов %s:T%s в текст."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Невозможно обновить выражение CreateForm в исходном коде проекта"

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Невозможно обновить двоичный файл ресурсов%s%s%sиз текстового файла ресурсов%s%s%s%sВероятно, текстовый файл повреждён."

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Невозможно записать %s%s%s%s%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Невозможно записать %s%s%s"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Невозможно записать файл"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Невозможно записать файл %s%s%s%sОшибка: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Невозможно записать файл информации о проекте%s%s%s%s.%sОшибка: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Невозможно записать файл сессии проекта%s\"%s\".%sОшибка: %s"

#: lazarusidestrconsts.lisunabletowritetofile
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Невозможно записать в файл %s%s%s."

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Невозможно произвести запись в файл \"%s\"."

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Невозможно записать поток XML в %s%sОшибка: %s"

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "Неожиданный результат:%sОтладчик прервёт работу."

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Удаление невозможно"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Удалить выбранное"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Модуль %s%s%s был изменён. Сохранить?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Идентификатор модуля существует"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s Модуль %s в пакете %s%s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль с таким именем уже имеется в проекте"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Имя модуля начинается с ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Имя модуля содержит ..."

#: lazarusidestrconsts.lisunitnotfound
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Модуль не найден в"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Каталог вывода модулей"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "путь модуля"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Пути к модулям"

#: lazarusidestrconsts.lisunitsnotfound2
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Модули не найдены в"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Беззнаковое"

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Неиспользуемые модули"

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr "Обновить предпросмотр"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Обновить ссылки?"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "Преобразовать регистр строки в верхний"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Преобразовать регистр строки, переданной в качестве параметра, в верхний."

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Сообщение со справкой (параметр -h)"

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr "Использовать..."

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr "Использовать строки Ansistring"

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Использовать исключающий фильтр"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Использовать идентификатор"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Использовать идентификатор %s в %s (%s)"

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Использовать включающий фильтр"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Запускающее приложение"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Использовать пакет %s в пакете %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Использовать пакет в пакете"

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Использовать пакет %s в проекте"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Использовать пакет в проекте"

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Домашний каталог пользователя"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Использовать модуль %s в модуле %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 с BOM"

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr "Значение:"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Значение%s"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Значения"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Вызовов методов"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Версия"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Вертикально"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Копировать информацию о версии в буфер обмена"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr "Показать параметры точки останова"

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Показать модули проекта"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Показать исходный текст (.lfm)"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Найти следующее"

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Сброс результатов"

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Предупреждение: найден файл с дублирующимся именем %s%s%s. Исходный файл: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sВнимание: этот модуль является главным. Новым главным модулем будет %s.pas."

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Наблюдать"

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Свойства наблюдения"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "Обновление ссылок при переименовании модуля"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "Если включено, текущие параметры сохраняются в шаблон, используемый при создании новых проектов"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "При перемещении курсора в редакторе исходного кода показывать текущий узел в обозревателе кода"

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr "%s, с включаемыми файлами %s"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", с включаемыми файлами "

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "С требуемыми пакетами"

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Добавить"

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Удалить"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "У&далить все"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "О&тключить все"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "В&ключить все"

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Включить"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Выражение"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Свойства"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Список наблюдений"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово под курсором в этом редакторе"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Рабочий каталог для сборки"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Рабочий каталог для запуска"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Ошибка записи"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Ошибка записи: %s%sФайл: %s%s%s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Ошибка XML"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Файлы XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Ошибка разбора XML в файле %s%sОшибка: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
#| msgid "You can disable this for individual forms via the popup menu in the source editor, file settings, i18n for lfm strings"
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Вы можете отключить это поведение для отдельных форм через всплывающее меню инспектора проекта"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Вы не можете пересобрать Lazarus при отладке или компиляции."

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Редактор исходного кода"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Добавлять модуль пакета в выражение uses"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Добавить инверсию"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Автоматически наращивать номер сборки"

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Доступные лексические анализаторы"

#: lazarusidestrconsts.rsbuild
#| msgid "Build:"
msgid "&Build:"
msgstr "С&борка:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Набор символов:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Закрыть текущую страницу"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Условные определения"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Создать новое определение"

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "Не удалось создать каталог \"%s\"!"

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "Не удалось создать символическую ссылку \"%s\"!"

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "Создание символических ссылок не поддерживается на данной платформе!"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Включить i18n"

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
#| msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "Введите одну или более фраз, которые вы хотите найти или отфильтровать в списке, разделяя их пробелами либо запятыми"

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "Фильтровать список результатов поиска по текущему выражению"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Файл данных формы (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Найденных, но не отображаемых здесь: "

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "Перейти к следующему элементу списка результатов поиска"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Параметры i18n"

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Добавлять информацию о версии в исполнимый файл"

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Пользовательская позиция"

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "По умолчанию"

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Прикрепить"

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Восстановить геометрию окна"

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Восстановить размер окна"

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Взять параметры оконного менеджера"

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Клавиша"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Африкаанс"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Арабский"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Автоматически (или английский)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Каталанский"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Китайский"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Чешский"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Голландский"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Английский"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Финский"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Французский"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Немецкий"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Иврит"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Индонезийский"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Итальянский"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Японский"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Литовский"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Параметры языка"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Польский"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Португальский"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Русский"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Выбор языка:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Словацкий"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Испанский"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Турецкий"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Украинский"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Старшая:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "&Младшая:"

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr "ОК"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Прочие сведения"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Каталог вывода файлов PO:"

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Удалить"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "Сбросить фильтр"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Ревизия:"

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Лексические анализаторы"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Выбрать унаследованный элемент"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Начать новый поиск"

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Значение"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Номера версий"

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Клавиша \"%s\" уже сопоставлена с \"%s\"."

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Альтернативная клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команды меню Справка"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Управляющие команды"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команды CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Команды выделения столбцов текста"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команды перемещения курсора"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Команды редактирования текста"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Команды меню Окружение"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Команды меню Файл"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Команды сворачивания текста"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Команды управления закладками исходного кода"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Команды меню Пакет"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команды меню Проект"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Команды меню Запуск"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команды поиска и замены текста"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Команды выделения текста"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команды управления редакторами исходного кода"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Синхронное редактирование"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Синхронное редактирование (не в поле)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Синхронное редактирование (при выделении)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Команды редактирования шаблонов"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Команды редактирования шаблонов (не в полях)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команды меню Сервис"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Команды меню Вид"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Команда:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr "    команда1 \""

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr "    команда2 \""

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Конфликт "

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " конфликтует с "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Прервать сборку"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Добавить точку перехода"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Добавить наблюдение"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Завершить шаблон кода"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Копировать выделенное"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Удалить выделенное"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Перейти к началу выделенного"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Перейти к концу выделенного"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Скрыть выделенное"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Увеличить отступ выделенного"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Переместить выделенное"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Установить начало выделения"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Установить конец выделения"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Показать выделенное"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Переключить видимость выделенного"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Уменьшить отступ выделенного"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Собрать программу/проект"

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "Собрать все файлы программы/проекта"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Собрать файл"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Собрать Lazarus"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Символ"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Удалить весь текст"

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Редактор определений CodeTools"

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Параметры Codetools"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Выделить снизу"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Выделить до самого конца"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Выделить до самого начала"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Выделить слева"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Выделить до конца строки"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Выделить до начала строки"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Выделить до начала текста в строке"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Выделить всю страницу снизу"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Выделить страницу снизу"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Выделить всю страницу сверху"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Выделить страницу сверху"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Выделить справа"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Выделить сверху"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Добавить в выделение слово слева"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Добавить в выделение слово справа"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим выбора столбца"

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "параметры компилятора"

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Завершить код"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "файл настроек сборки"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Копировать выделенное в буфер"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Копировать редактор в новое окно"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Копировать редактор в следующее свободное окно"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Копировать редактор в предыдущее свободное окно"

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Средство пользователя %d"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Вырезать выделенное в буфер"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Удалить до начала строки"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Удалить символ у курсора"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Удалить до конца строки"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Удалить последний символ"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Удалить до начала слова"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Удалить текущую строку"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Удалить до конца слова"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Разница Diff"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Переместить курсор в самый конец"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Переместить курсор в самое начало"

#: lazarusidestrconsts.srkmecenvironmentoptions
#| msgid "General environment options"
msgid "IDE options"
msgstr "Параметры IDE"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "рассчитать/изменить"

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Внешнее средство %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Параметры внешних средств"

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Найти текст"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Найти другой конец блока"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Найти начало блока"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Найти объявление"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Найти в файлах"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Найти далее"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Найти следующее вхождение слова"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr "Найти перегруженные"

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Найти предыдущее"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Найти предыдущее вхождение слова"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Найти объявление процедуры"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Найти тело процедуры"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Свернуть текст под курсором"

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Свернуть до уровня %d"

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Перейти к редактору %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Перейти по директиве include текущего включаемого файла"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Перейти к строке номер"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Перейти к закладке %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Перейти по координате"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Предположить отсутствие $IFDEF"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставить элемент ChangeLog"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставить из таблицы символов"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставить ключевое слово CVS Author"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставить ключевое слово CVS Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставить ключевое слово CVS Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставить ключевое слово CVS ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставить ключевое слово CVS Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставить ключевое слово CVS Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставить ключевое слово CVS Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставить ключевое слово CVS Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставить текущие дату и время"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставить заметку о GPL"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставить заметку о LGPL"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Разорвать строку, оставить курсор"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Вставить заметку о модифицированной LGPL"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Вставить текущее имя пользователя"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "просмотреть"

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Разорвать строку, сдвинуть курсор"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Переместить курсор в конец строки"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Режим выбора строк"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Переместить курсор в начало строки"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Переместить курсор на начало текста в строке"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Зафиксировать положение в редакторе"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Создать строку ресурсов"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Перейти к парной скобке"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Сместить редактор влево"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Поместить редактор слева"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Переместить редактор в новое окно"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Переместить редактор в следующее свободное окно"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Переместить редактор в предыдущее свободное окно"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Сместить редактор вправо"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Поместить редактор справа"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Следующая закладка"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Перейти к следующему редактору"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Перейти к следующему редактору с тем же файлом исходного кода"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Перейти к следующему окну"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальный режим выбора"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Открыть файл у курсора"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим замены"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Переместить курсор в конец страницы"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Переместить курсор вниз на одну страницу"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Переместить курсор влево на одну страницу"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Переместить курсор вправо на одну страницу"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Переместить курсор в начало страницы"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Переместить курсор вверх на одну страницу"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Вставить из буфера в текущую позицию"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "приостановить программу"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Предыдущая закладка"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Перейти к предыдущему редактору"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Перейти к предыдущему редактору с тем же файлом исходного кода"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Перейти к предыдущему окну"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Быстрая компиляция, без компоновки"

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr "Выход"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "Удалить точку останова"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Удалить пустые методы"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr "Удалить неиспользуемые модули"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Переименовать идентификатор"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Заменить текст"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr "Сообщить об ошибке"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "Сбросить отладчик"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Запустить программу"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "Запустить файл"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "Параметры запуска"

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Сохранить"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутить вниз на одну строку"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутить влево на один символ"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутить вправо на один символ"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутить вверх на одну строку"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Выделить вниз"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Выделить все"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Выделить до самого конца"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Выделить до самого начала"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Выделить до координаты XY"

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "SelLeft"

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Выделить конец строки"

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Выделить начало строки"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Выделить до начала текста в строке"

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Выделить низ страницы"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Выделить страницу снизу"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Выделить страницу слева"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Выделить страницу справа"

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Выделить верх страницы"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Выделить страницу сверху"

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "SelRight"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Выделить вверх"

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Выделить слово слева"

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Выделить слово справа"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Установить закладку %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Сдвинуть ТАБ"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Показать абстрактные методы"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Показать контекст кода"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "показать точку исполнения"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "остановить программу"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Перейти к концу поля"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Перейти к началу поля"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Выбрать поле"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Отменить"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Следующее поле"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Следующее поле (все выбранные)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Предыдущее поле"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Предыдущее поле (все выбранные)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Начать синхронное редактирование"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Перейти к концу поля"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Перейти к началу поля"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Выбрать поле"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Отменить"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Завершить"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Следующее поле"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Следующее поле (по кругу)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Следующее поле (все выбранные)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Следующее поле (по кругу / все выбранные)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Предыдущее поле"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Предыдущее поле (все выбранные)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Проверить синтаксис"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Просмотр кода ассемблера"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr "Переключить точку останова"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Просмотр точек останова"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Просмотр стека вызовов"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Показать браузер кода"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показать обозреватель кода"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Показать палитру компонентов"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Просмотр вывода отладчика"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Переключить модуль/форму"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Показать редактор документации"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Показывать кнопки быстрого доступа IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Просмотр локальных переменных"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Переключить закладку %d"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Переключение режима подсветки текущего слова"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Просмотр сообщений"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Переключить режим"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показать инспектор объектов"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Просмотр значений регистров"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Показать браузер ограничений"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показать результаты поиска"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показать редактор исходного кода"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Показать наблюдения"

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "Развернуть всё"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Развернуть текст под курсором"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "неизвестная команда редактора"

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Сначала пользовательский"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показать редактор привязок"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Показать список компонентов"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Показать формы"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показать зависимости модулей"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Показать сведения о модуле"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Показать модули"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Завершить слово"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Переместить курсор на слово влево"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Переместить курсор на слово вправо"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Редактирование клавиш вызова команды"

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Изменить клавиши"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Захватить клавишу"

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Захватить вторую клавишу"

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Клавиша (или двухклавишная комбинация)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Нажмите любую клавишу..."

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Свернуть комментарии в выделенном"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Скрыть комментарии в выделенном"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr "Развернуть всё в выделенном"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr "Развернуть комментарии в выделенном"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Файл только для чтения"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Файл \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" не для записи."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Зафиксирован"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Добавить &наблюдение у курсора"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Закладка"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Закрыть &другие страницы"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Закрыть страницу"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Завершить код"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Копировать"

#: lazarusidestrconsts.uemcopyfilename
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Копировать имя файла"

#: lazarusidestrconsts.uemcopytonewwindow
#| msgid "Copy to new Window"
msgid "Clone to new Window"
msgstr "Клонировать в новом окне"

#: lazarusidestrconsts.uemcopytootherwindow
#| msgid "Copy to other Window"
msgid "Clone to other Window"
msgstr "Клонировать в другом окне"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Новое окно"

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Вырезать"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Отладка"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Свойства редактора"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Заключить выделенное"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Кодировка"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr "&Вычислить/Изменить..."

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Выделить процедуру"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Найти объявление"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Найти ссылки на идентификатор"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Перейти по закладке"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Подсветка синтаксиса"

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr "&Просмотреть..."

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Инвертировать присвоение"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "Конец строки"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "З&афиксировать положение в редакторе"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "Переместить страницу влево"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "Поместить страницу слева"

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "Переместить страницу вправо"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "Поместить страницу справа"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "Переместить в новое окно"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr "Переместить в другое окно"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Новое окно"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Перейти к следующей закладке"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Изменён"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Открыть файл у курсора"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Вставить"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Перейти к предыдущей закладке"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Перейти к процедуре"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Только чтение"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Переработка кода"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Переименовать идентификатор"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "За&пустить до курсора"

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Установить закладку"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Установить свободную закладку"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Показывать номера строк"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Сведения о модуле"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "П&ереключить закладку"

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr "П&ереключить точку останова"

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Показать стек вызовов"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Еще не реализовано"

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Вам сказано: не реализовано"

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Если Вы можете помочь нам реализовать эту функцию, пишите на lazarus@miraclec.com"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "ВСТ"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "ЗАМ"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Только чтение"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Информация о версии"