lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.id.po

msgid ""
msgstr ""
"Project-Id-Version: Lazarus 1.x\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2007-09-22 01:16+0700\n"
"Last-Translator: Zaenal Mutaqin <ade999@gmail.com>\n"
"Language-Team: Indonesian <ade999@gmail.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr ""

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Umum"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Teks"

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr ""

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr ""

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr ""

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Hanya Baca"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Huruf kecil, huruf pertama besar"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Baris"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Teks"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr ""

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Path pencarian Sumber Tambahan untuk semua proyek (.pp;.pas)"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Tambah titik koma"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Sesuaikan baris atas karena komentar di depan"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Semua file"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Secara alfabetik"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr ""

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Aksi file tidak jelas:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Peringatan saat kompilasi"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Seting Aplikasi"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Default"

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Sertakan Kode Assertion"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Otomatis-buat form:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "ketika pembuatan form baru, tambahkan ke otomatis-buat form"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Otomatis menghapus file"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr ""

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr ""

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr ""

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr ""

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Otomatis mengganti nama file ke huruf kecil"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Otomatis menyimpan"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Form tersedia:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Latar belakang"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(tidak ada sub direktori)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Nama sama (dalam subdirektori)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Disamping metode"

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr ""

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Indent blok"

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr ""

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr ""

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Kompatibel TP/BP 7.0"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr ""

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr ""

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Terapkan"

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr ""

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr ""

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr ""

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Uji"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr ""

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr ""

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Urutan Class"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Terakhir"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "huruf kecil"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Peninjauan (Maks panjang baris = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefiks Read"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Akhiran Stored"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "HURUF BESAR"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefiks Variable"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefiks Write"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Tengahkan Baris Kursor"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Simpan Sebagai - otomatis mengganti nama file pascal ke huruf kecil"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Periksa konsistensi"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr ""

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Pilih file template kode (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Bagian Class menyisipkan kebijakan"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Tampilkan tombol tutup dalam notebook"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Skema Warna"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Gaya Makro C (global)"

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Gunakan Ansi Strings"

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "Seadanya"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr ""

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr ""

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Periksa:"

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Kompilasi"

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr ""

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Operator Gaya C (*=, +=, /= and -=)"

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr ""

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Buat Makefile"

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr ""

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr ""

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Hasilkan Info Debugging untuk DBX (Kompilasi Lambat)"

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Debugging:"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Tambahan path Debugger (tidak ada):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Pembuatan Kode"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr ""

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""

#: lazarusidestrconsts.dlgcodegeneration
#, fuzzy
#| msgid "Code"
msgid "Code generation"
msgstr "Kode"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Opsi CodeTools"

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Kode Lebih Cepat"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "hasilkan Info Debugging untuk GDB (Kompilasi Lambat)"

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Hasilkan:"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Gunakan Unit Heaptrc"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "File Include (-Fi):"

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Diturunkan"

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr ""

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Pustaka (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Penggabungan"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Ambil/Simpan"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr ""

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr ""

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr ""

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr ""

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr ""

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parameter baris perintah (tanpa nama aplikasi)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr ""

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr ""

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr ""

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr ""

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr ""

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opsi Kompilator"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Lengkapi properti"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "File Konfig:"

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Kode Normal"

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Opsi:"

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Lainnya"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Kelebihan"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Penguraian"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr ""

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr ""

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Jangkauan"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Tampilkan Kesalahan"

#: lazarusidestrconsts.dlgcoshowoptions
#, fuzzy
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Tampilkan Opsi"

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Kode Lebih Kecil"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Linkable Pintar"

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Sumber Lain (file .pp/.pas, hanya digunakan oleh IDE bukan oleh kompilator)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Tumpukan"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Hilangkan Simbol Dari Eksekutabel"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Gaya Unit:"

#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr ""

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Hasilkan kode untuk valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr ""

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "Gaya C++ INLINE"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Kursor setelah EOL"

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr ""

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Ekstensi ditetapkan pemakai (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr ""

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Path dan Tipe Debugger"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Font editor default"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Nilai default"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Ekstensi Delphi 2"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Hapus template"

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Kompatibel Delphi"

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Desktop"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "File Desktop"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr ""

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr ""

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr ""

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Arah"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Direktori tidak ada"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr ""

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr ""

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr ""

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr ""

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr ""

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr ""

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr ""

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr ""

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr ""

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr ""

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr ""

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr ""

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Turun"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Tambah..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Kembali"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Tebal"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sub direktori"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Template kode"

#: lazarusidestrconsts.dlgedcolor
#, fuzzy
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Warna"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for pascal blocks"
msgstr ""

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Ekstensi ditetapkan pemakai"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Penangguhan"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Hapus"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Tampilan"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Edit..."

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "File Editor"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Pelengkapan pengenal"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr ""

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr ""

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Miring"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Font editor"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Tinggi font editor"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opsi Editor"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr ""

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Tidak ditemukan kesalahan dalam pemetaan kunci."

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr ""

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr ""

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Garis bawah"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr ""

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr ""

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr ""

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Tanya"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Catatan: File Proyek adalah semua file dalam direktori proyek"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Warna"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "File"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grid"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Bahasa"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Garis Pemandu"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Lain-lain"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Tidak ada"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "File Lain"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Proyek"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipe"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr ""

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr ""

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "baris spasi ekstra"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr ""

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Ekstensi file"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Cari teks di kursor"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr ""

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "File"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr ""

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr ""

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr ""

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Warna latar depan"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Kebijakan penyisipan Procedure"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Biarkan urutan dari procedure"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Path kompilator (%s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Direktori sumber FPC"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr ""

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor Form"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr ""

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Opsi"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr ""

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Ambil posisi"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr ""

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Kompatibel GPC (GNU Pascal Compiler)"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Hasilkan kode untuk gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Warna Penggengam"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Warna grid"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Besar grid X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Besar langkah grid horisontal"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Besar grid Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Besar langkah grid vertikal"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr ""

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr ""

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr ""

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr ""

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Lingkungan"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Panduan"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Undi Grup"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Tampilkan Garis Pemandu"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Warna saluran"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr ""

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr ""

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Panjang saluran"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Gulung setengah halaman"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Besar Heap"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Tinggi:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Sembunyikan jendela IDE saat menjalankan"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr ""

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr ""

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr ""

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr ""

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr ""

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Tampilkan Petunjuk untuk parameter \"Sender\" tidak digunakan"

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Tampilkan Petunjuk untuk unit yang tidak digunakan dalam sumber utama"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Kunci Home melompat ke awal terdekat"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Aplikasi Induk"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Pelengkapan pengenal"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Kebijakan pengenal"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr ""

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Abaikan"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Sertakan variabel sistem"

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Kode Indent ke"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr ""

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Di depan metode"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Nama Constructor harus 'init' (destructor harus 'done')"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Sisipkan spasi setelah"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Sisipkan spasi di depan"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Interval dalam detik"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Lompatan (contoh Lompatan Metode)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr ""

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Pemetaan Kunci"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Pemetaan kunci salah"

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Skema Pemetaan Kunci"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Kebijakan Kata kunci"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Ijinkan LABEL dan GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Bahasa"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Terakhir (contoh di akhir dari sumber)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Direktori Lazarus (default untuk semua proyek)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Kiri:"

#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "warna untuk kiri, atas"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Tingkat 1 (cepat dan ramah debugger)"

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr ""

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Tingkat 3 (Tingkat 2 + optimasi lambat)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Tingkat 0 (tidak ada Optimasi ekstra)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Pemisahan Baris"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Gaya Link:"

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Link Pintar"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Tampilkan Nomor Baris dalam Penelusuran Kesalahan Run-time"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Ambil seting desktop dari file"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu Utama"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Lihat form proyek"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr ""

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Lihat unit proyek"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Path Make"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margin dan saluran"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Warna Penanda"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr ""

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Penghitung maksimum"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maks panjang baris:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maks file terbaru"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maks file proyek terbaru"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Kebijakan penyisipan Metode"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Campur metode dan properti"

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Left"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Right"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Hidupkan"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr ""

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Tambah"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Hapus"

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Turun"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Left"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptbtnok
#, fuzzy
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "Ok"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Right"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Ubah"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Naik"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Urutan"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Teks"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Pemilihan"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr ""

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr ""

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr ""

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Pilihan Multi"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr ""

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr ""

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr ""

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Penamaan"

#: lazarusidestrconsts.dlgnoautomaticrenaming
#, fuzzy
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Tanpa otomatis penggantian nama"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Left"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Right"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr ""

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Jangan pisah baris setelah:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Jangan pisah baris Di depan dari:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr ""

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Tinggi item"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Lain-lain"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Opsi"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr ""

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr ""

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimasi:"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "File Unit Lain (-Fu) (Pemisah adalah titik koma):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr ""

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr ""

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Petunjuk untuk palet komponen"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Ekstensi pascal default"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr ""

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Opsi Operan Ke Penggabung (Pemisah adalah spasi)"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr ""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Default"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Tidak ada"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr ""

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr ""

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr ""

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplikasi"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr ""

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr ""

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr ""

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Forms"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr ""

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr ""

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr ""

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr ""

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr ""

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Lain-lain"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Seting Output"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr ""

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sesi"

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Nama file target:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Judul:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Gunakan Bundel Aplikasi untuk menjalankan dan debugging (hanya darwin)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Gunakan file manifest untuk menghidupkan tema (hany windows)"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opsi Proyek"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr ""

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "File Proyek"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr ""

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Melengkapi properti"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nama properti"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr ""

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Buka proyek terakhir saat mulai"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Tampilan ruang batas"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr ""

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Tampilkan grid"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Menempel ke grid"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referensi"

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr ""

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Ganti &Semua"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Ganti Dengan"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Laporan"

#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "warna untuk kanan, bawah"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Klik Kanan memilih"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margin kanan"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Direktori Pekerjaan"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr ""

#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Pembuatan"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Pemilihan"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Tampilan (tidak untuk win32, contoh 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Lingkungan"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokal"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variabel sistem"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Gunakan tampilan"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Penolakan pemakai"

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr ""

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Variabel"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Parameter Menjalankan"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Simpan seting desktop ke file"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr ""

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Simpan info editor untuk file yang ditutup"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Simpan info editor hanya untuk file proyek"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Cakupan"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Gulung dengan kurang satu"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr ""

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Tampilkan petunjuk menggulung"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Gulung ke akhir file"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Gulung ke akhir baris"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr ""

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Pencarian dibatalkan oleh pemakai."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Pencarian..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Path"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr ""

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Set semua elemen ke default"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Set elemen ke default"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Set property Variable"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Tampilkan judul komponen"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Tampilkan procedure yang dikompilasi"

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Opsi tampilan kompilator"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr ""

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Tampilkan kondisional"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Tampilkan info debug"

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Tampilkan makro yang ditetapkan"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Tampilkan petunjuk editor"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Tampilkan apapun"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Tampilkan info eksekutabel (hanya Win32)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Tampilkan info umum"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Tampilkan petunjuk saluran"

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Tampilkan Petunjuk"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Tampilkan nomor baris"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Tampilkan Catatan"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Tidak menampilkan apapun (hanya kesalahan)"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Tampilkan semua procs pada kecalahan"

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Tampilkan petunjuk menggulung"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Tampilkan ringkasan"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Tampilkan file yang dicoba"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Tampilkan file yang digunakan"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Tampilkan Peringatan"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr ""

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr ""

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tab pintar"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Simbol dibelakang (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Penghitung (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Simbol didepan (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Menempel ke Garis Pemandu"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Spasi"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Petunjuk untuk tombol cepat utama (buka, simpan, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr ""

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Asalnya"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Kata kunci statik dalam Objek"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Hentikan setelah sejumlah kesalahan:"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr ""

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opsi sintaks"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab memajukan blok"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr ""

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tab ke spasi"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr ""

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr ""

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr ""

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Target Platform:"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr ""

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Direktori untuk pembangunan proyek tes"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Teks yang Dicari"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Direktori \""

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "det"

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Evaulasi ekspresi tooltip"

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Piranti simbol tooltip"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Atas:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Nama file template"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr ""

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr ""

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Hapus sisa spasi"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Optimasi Tidak pasti"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Undo setelah menyimpan"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr ""

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Batas Undo"

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr ""

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Ketergantungan unit"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Segarkan"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Direktori output unit (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr ""

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Naik"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Lipatan kode"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr ""

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr ""

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Gunakan File Konfig Kompilator standar (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Gunakan aplikasi peluncuran"

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr ""

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr ""

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Gunakan penerangan sintaks"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Nilai"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Perlihatkan selama kompilasi:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Nampak saluran"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Nampak margin kanan"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr ""

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Panjang:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr ""

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Jendela"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Posisi Jendela"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Kata"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Peninjauan"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Tulis logo FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Pemilihan multi komponen harus dari form tunggal."

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Penjajaran"

#: lazarusidestrconsts.fdmdeleteselection
#, fuzzy
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Penilihan penghapusan"

#: lazarusidestrconsts.fdmmirrorhorizontal
#, fuzzy
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Cerminkan horisontal"

#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Cerminkan vertikal"

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Urutan"

#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Mundur satu"

#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Maju satu"

#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Pindahkan ke belakang"

#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Pindahkan ke depan"

#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Simpan form sebagai xml"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skala"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Pilih Semua"

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Ukuran"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opsi: Menempel ke grid"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opsi: Menempel ke garis pemandu"

#: lazarusidestrconsts.fdmtaborder
#, fuzzy
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Urutan tab..."

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr ""

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr ""

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Tambah File"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Tambah File"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Tambah file ke paket"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Tambah file LFM, LRS, jika ada"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Tambah file ke paket"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Tambah Unit"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipe Karuhun Dwimakna"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nama Class Dwimakna"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nama Unit Dwimakna"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Tipe Karuhun"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dependensi Rusak"

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr ""

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Nama Class sudah ada"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Buat file baru"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dependensi"

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sFile yang sudah ada: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "File sudah ada"

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "File %s%s%ssudah ada dalam proyek."

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "File sudah dalam paket"

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "File sudah digunakan"

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Nama file:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Nama file"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "File bukan unit"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipe Karuhun tidak benar"

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Lingkaran tidak benar"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nama Class tidak benar"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "File tidak benar"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nama file tidak benar"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nama Unit tidak benar"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s bukan nama unit yang benar."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nama class baru:"

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Komponen Baru"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "File Baru"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Tidak ada paket ditemukan untuk dependensi %s%s%s.%sSilahkan pilih paket yang sudah ada."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nama Halaman terlalu panjang"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Halaman Palet:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Simpan dialog file"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Nama file pendek atau panjang"

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Tampilkan semua"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Tukar Path"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Tipe karuhun %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Tipe karuhun %s%s%s bukan pengenal pascal yang benar."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Nama class %s%s%s dan tipe karuhun %s%s%s sama."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Nama class %s%s%s sudah ada dalam%sPaket %s%s%sFile: %s%s%s"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Nama class %s%s%s mempunyai nama yang sama dengan%sunit %s%s%s."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Nama class %s%s%s bukan pengenal pascal yang benar."

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "File %s%s%s sudah dalam paket."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "File %s%s%s adalah bagian dari proyek saat ini.%sAdalah ide buruk untuk membagi file diantara proyek dan paket."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Nama file %s%s%s dwimakna, karena paket belum mempunyai direktori default. %sSilahkan tetapkan nama file dengan path penuh."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr ""

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr ""

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Paket sudah mempunyai dependensi untuk paket %s%s%s."

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Nama paket  %s%s%s tidak benar.%sSilahkan pilih paket yang sudah ada."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Nama halaman %s%s%s terlalu panjang (maks 100 karakter)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Nama unit %s%s%s sudah ada dalam paket:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Nama unit %s%s%s sudah ada dalam paket ini."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Nama unit %s%s%s dan nama file %s%s%s berbeda."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Nama unit %s%s%s tidak terkait ke nama file."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Nama unit %s%s%s sama dengan komponen terdaftar.%sMenggunakan ini bisa menyebabkan pesan kesalahan aneh."

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Nama file unit:"

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Nama File Unit:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Nama Unit:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nama unit sudah ada"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nama Unit tidak benar"

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Pindai Unit untuk Nama Unit dan prosedur Register"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr ""

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr ""

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Gugurkan semua"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Batalkan semua pengambilan"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Batalkan pengambilan proyek"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Batalkan seluruh pengambilan"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr ""

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Tentang Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Lisensi: GPL/LGPL%sLazarus adalah IDE untuk membuat aplikasi (grafis dan konsol) dengan Free Pascal. Free Pascal adalah (L)GPL kompilator Pascal dan Object Pascal yang berjalan pada Windows, Linux, Mac OS X, FreeBSD dan banyak lagi.%sLazarus adalah bagian yang hilang dari teka-teki yang akan membolehkan anda mengembangkan program untuk semua platform di atas dalam lingkungan mirip Delphi. IDE adalah piranti RAD yang menyertakan desainer formulir.%sKarena Lazarus berkembang kami memerlukan lebih banyak para pengembang."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Tidak menemukan daftar kontributor."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr ""

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s tidak bisa menampung TControls.%sAnda hanya bisa menaruh komponen visual diatasnya."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Pengakuan"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr ""

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr ""

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktifkan aturan ekspresi reguler untuk teks dan penggantian (mirip sekali dengan perl)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr ""

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr ""

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr ""

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Opsi kompilator tambahan diturunkan dari paket"

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr ""

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr ""

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr ""

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr ""

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Tambah %s ke proyek?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr ""

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr ""

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr ""

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr ""

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Tambah file ke paket"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Paket Tujuan"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Tipe File"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Mempunyai prosedur Register"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Paket Tidak benar"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "ID paket tidak benar: %s%s%s"

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Unit virtual (sumber tidak dalam paket)"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Paket hanya baca"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Paket %s%s%s tidak ditemukan."

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Tampilkan Semua"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr ""

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Paket %s hanya baca."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Nama Unit:"

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "File %s%s%s sudah ada.%sTimpa saja?"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Penjajaran"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Seluruh blok terlihat ok."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Semua File"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr ""

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr ""

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Ijinkan pencarian untuk multipel baris"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr ""

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr ""

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr ""

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr ""

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr ""

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "File dwimakna ditemukan"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "File yang tidak jelas ditemukan: %s%s%s%sFile ini mungkin salah dengan %s%s%s%s%sHapus file tidak jelas?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "File yang meragukan ditemukan"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Unit Dwimakna ditemukan"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr ""

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor Anchor - tidak ada kontrol dipilih"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr ""

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Anchor dari kontrol yang dipilih"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Anchor ke sisi bawah dari yang terdekat, biarkan batas spasi"

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Anchor ke sisi kiri dari yang terdekat, biarkan batas spasi"

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Anchor ke sisi kanan dari yang terdekat, biarkan batas spasi"

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Anchor ke sisi atas dari yang terdekat, biarkan batas spasi"

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Kesalahan terjadi saat terakhir startup ketika mengambil %s!%s%sAmbil proyek ini lagi?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr ""

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#, fuzzy
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Aplikasi%sProgram grafis lcl/freepascal. File program otomatis dipelihara oleh lazarus."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr ""

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr ""

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr ""

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Batas spasi sekeliling kontrol. Batas spasi ke empat lainnya ditambahkan ke nilai ini"

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "File Program Pascal sederhana.%sIni bisa digunakan untuk pengujian cepat dan kasar.%Lebih baik buat proyek baru."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Tanya sebelum mengganti setiap teks yang ditemukan"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr ""

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr ""

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr ""

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr ""

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr ""

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr ""

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr ""

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr ""

#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Fitur otomatis"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr ""

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Paket Tersedia"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr ""

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Mem-backup file gagal"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Pengubahan nama paket atau versi memisahkan dependensi. Apakah dependensi ini diubah juga?%sPilih Ya untuk mengubah semua dependensi terdaftar.%sPilih Abaikan untuk memisahkan dependensi dan melanjutkan."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "mulai"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr ""

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Selalu Membangun sebelum Dijalankan"

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Bangun"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Perintah Bangun"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Saat membangun proyek sebaliknya menjalankan perintah Bangun File"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Saat menjalankan proyek sebaliknya menjalankan perintah Jalankan File"

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Jalankan"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Jalankan Perintah"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Ketika file ini aktif dalam editor sumber ..."

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Direktori kerja (biarkan kosong untuk path file)"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Direktori Kerja (biarkan kosong untuk path file)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr ""

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "BatasSpasi"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr ""

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Batas spasi Bawah. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dibawah kontrol."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Anchor Bawah"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bawah"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Ini adalah kontrol terdekat dimana sisi bawah dianchor. Biarkan kosong untuk parent."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Bawah spasi secara sama"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr ""

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Melihat Kompilator (%s)"

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr ""

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Lanjutkan"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr ""

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr ""

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr ""

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr ""

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr ""

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr ""

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Bangun proyek baru"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Angka Buatan"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr ""

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Batalkan pengambilan komponen ini"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Batalkan pengambilan unit"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Batalkan penggantian nama"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Tidak bisa meng-copy komponen tingkat teratas."

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Tidak bisa membuat file %s%s%s"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Tidak bisas menemukan starter lazarus:%s%s"

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Hanya bisa mengubah kelas dari TComponents."

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr ""

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr ""

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr ""

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr ""

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr ""

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr ""

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr ""

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr ""

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr ""

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Salah"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr ""

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr ""

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr ""

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr ""

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr ""

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr ""

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr ""

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr ""

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr ""

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr ""

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr ""

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr ""

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr ""

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr ""

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr ""

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr ""

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr ""

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr ""

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr ""

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr ""

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr ""

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr ""

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr ""

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr ""

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr ""

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr ""

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr ""

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr ""

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr ""

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr ""

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr ""

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr ""

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr ""

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filter)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Mengikuti kursor"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr ""

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr ""

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr ""

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr ""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr ""

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr ""

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr ""

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr ""

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr ""

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Tengahkan kontrol secara horisontal relatif ke yang terdekat"

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Tengahkan kontrol secara vertikal relatif ke yang terdekat"

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr ""

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Tengah dalam jendela"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Tengah"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr ""

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr ""

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr ""

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Tidak pernah, hanya secara manual"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr ""

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Saat menganggur"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Segarkan secara otomatis"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Lainnya"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Mutahirkan"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Saat menukar file dalam editor sumber"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr ""

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr ""

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr ""

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr ""

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr ""

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr ""

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr ""

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr ""

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr ""

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr ""

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr ""

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr ""

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr ""

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Ubah Kelas"

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr ""

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr ""

#: lazarusidestrconsts.lischangeparent
#, fuzzy
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "Ubah leluhur ..."

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr ""

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Peta Karakter"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Periksa perubahan pada disk tanpa pengambilan"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr ""

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Pilih nama yang berbeda"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr ""

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr ""

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr ""

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr ""

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr ""

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Pilih nama file kompilator (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Pilih nama file debugger"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr ""

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Pilih unit Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Pilih direktori"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Pilih direktori sumber FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Pilih Direktori Lazarus"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Pilih path make"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr ""

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Pilih satu dari item-item ini untuk membuat File baru"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Pilih satu dari item-item ini untuk membuat Paket baru"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Pilih satu dari item-item ini untuk membuat Proyek baru"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr ""

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Pilih sumber program (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Pilih struktur untuk menyertakan pilihan"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr ""

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr ""

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr ""

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr ""

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Class %s%s%s tidak terdaftar sebagai kompnen class.%sTidak bisa mem- paste."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Class tidak ditemukan"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Bersihkan Direktori"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Bersihkan sub direktori"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Biarkan semua file teks"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Biarkan file yang memenuhi filter"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Hapus file yang memenuhi filter"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintaks Sederhana (contoh. * instead of .*)"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Bersihkan Sumber Lazarus"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "bersihkan path unit?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr ""

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr ""

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr ""

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Tutup"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr ""

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr ""

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr ""

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr ""

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opsi khusus Antarmuka LCL"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr ""

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr ""

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr ""

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr ""

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "File konfig kompilator tambahan tidak jelas"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Panggilan pada:"

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Bangun"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Kompilasi"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Jalankan"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKlik OK jika anda yakin akan melakukannya."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Perintah:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Browser Kode"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr ""

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "default (%s)"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr ""

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Tambah link"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Tambah path"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr ""

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr ""

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr ""

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Hapus link"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Hapus path"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr ""

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr ""

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Contoh"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Sisipkan tag format kode"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Sisipkan tag format miring"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Sisipkan tag format catatan"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Sisipkan tag format garis bawah"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Sisipkan tag format var"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Diturunkan"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr ""

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr ""

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr ""

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr ""

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr ""

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<TIDAK ADA>"

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr ""

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr ""

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr ""

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Lihat juga"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr ""

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Pendek"

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr ""

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr ""

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr ""

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr ""

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr ""

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr ""

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Tambah"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Tambah template kode"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Token %s%s%s sudah ada! "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr ""

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Ubah"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Komentar:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Edit template kode"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Salah"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Aksi: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Node otomatis dibuat tidak bisa diedit,%stidak juga mempunyai node anak yang tidak otomatis dibuat."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, otomatis dibuat"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Node yang otomatis dibuat tidak bisa diedit."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor Definisi CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Peninjauan Definisi CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "path kompilator"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Konversi node"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Buat Defines untuk Direktori %s"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Buat Defines untuk Kompilator Free Pasal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Buat Defines untuk Sumber Free Pascal SVN"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Buat Defines untuk Direktori Lazarus"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Buat Defines untuk Proyek %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Buat Makro FPC dan path untuk direktori proyek fpc"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definiskan"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definisikan Berulang"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Hapus node"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Direktori utama %s, %sdimana Borland telah menginstalasi semua sumber %s.%sSebagai contoh: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Deskripsi:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "direktori %s"

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Edit"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Kesalahan pembacaan %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Kesalahan pembacaan file info proyek %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Kesalahan ketika penulisan %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Kesalahan ketika penulisan file info proyek %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Keluar"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Keluar tanpa Menyimpan"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Direktori sumber FPC SVN"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Direktori"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Sisipkan Template Proyek Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Sisipkan Template Proyek Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Sisipkan Template Kompilator Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Sisipkan Template Direktori Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Sisipkan Template Proyek Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Sisipkan Template Kompilator Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Sisipkan Template Proyek Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Sisipkan Template Sumber SVN Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Sisipkan Template Kompilator Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Sisipkan Template Direktori Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Sisipkan Template Proyek Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Sisipkan Template Direktori Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Sisipkan node sebagai anak"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Sisipkan node dibawah"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Sisipkan Template"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Induk tidak benar"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Node induk tidak benar"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Node sebelumnya tidak benar"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s.%sContoh: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Direktori utama %s,%sdimana Borland telah menginstalasi semua sumber %s,%syang digunakan oleh proyek %s ini.%sSebagai contoh: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Direktori Lazarus"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Turunkan node"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Turunkan node selangkah"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Naikkan node selangkah"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Naikkan node"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nama:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NodeBaru"

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Node dan anaknya hanya berlaku untuk proyek ini"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Node hanya-baca"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "tidak ada yang dipilih"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Node induk tidak bisa berisi node anak."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Node sebelumnya tidak bisa berisi anak node."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Direktori proyek %s"

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Pembacaan salah"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Simpan dan Keluar"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Node Terpilih:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Direktori sumber Free Pascal SVN. Tidak diperlukan. Ini akan meningkatkan pencarian deklarasi dan debugging."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Direktori proyek Free Pascal."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Direktori sumber Free Pascal SVN."

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Direktori utama Lazarus."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Path ke kompilator free pascal. %s Sebagai contoh %s/usr/bin/%s -n%s atau %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Path ke kompilator free pascal. Hanya diperlukan jika anda menset sumber FPC SVN dibawah ini. Digunakan untuk pembuatan makro otomatis."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Direktori proyek %s,%syang berisi file .dpr, dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Tidak didefiniskan"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Tidak didefinisikan Semua"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Tidak didefinisikan Berulang"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr ""

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Nilai sebagai Teks"

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variabel:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Penulisan salah"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Di"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr ""

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Titik dua"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Koma"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Pengenal"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Kata kunci"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Baris baru"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Tidak ada"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nomor"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "Ok"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Titik"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Titik koma"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Spasi"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Konstan string"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Simbol"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Jalankan setelah"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Jalankan sebelum"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Sempitkan semua kelas"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Sempitkan semua paket"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Sempitkan semua unit"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Perintah setelah"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Perintah seteleahnya tidak benar"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Perintah setelah mempublikasikan modul"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parameter baris perintah dari program"

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Kompilasi IDE (tanpa penggabungan)"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Kompilator"

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Kompilator salah"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Salah: kompilator tidak benar: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nama file kompilator"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Petunjuk: anda bisa menset path kompilator dalam Lingkungan->Opsi Lingkungan->File->Path Kompilator"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "CATATAN: file konfig codetools tidak ditemukan - menggunakan default"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "CATATAN: pengambilan file opsi codetools lama:"

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Opsi Kompilator untuk Proyek: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (kompilasi ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "Komponen"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr ""

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Nama kompionen %s%s%s adalah kata kunci"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Nama komponen %s%s%s bukan pengenal yang benar"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Cari komponen"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Buka paket"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Buka unit"

#: lazarusidestrconsts.liscomptest
#, fuzzy
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "Uji"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr ""

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr ""

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Direktori konfig Lazarus"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Konfigurasi Pembangunan %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr ""

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Konfirmasi perubahan"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr ""

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Anda ingin membangun ulang Lazarus?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr ""

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr ""

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr ""

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Aplikasi Konsol"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr ""

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "berisi"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr ""

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Lanjutkan"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Lanjutkan tanpa pengambilan form"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Kontributor"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Kontrol membutuhkan leluhurnya"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr ""

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr ""

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Konversi salah"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr ""

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr ""

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr ""

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr ""

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlaz
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphi
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlazwinonly
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr ""

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr ""

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr ""

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Copy Salah"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Copy salah"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Meng-copy seluruh form tidak diimplementasikan."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr ""

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Copy pesan yang dipilih ke clipboard"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Cari pesan FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Cari pesan Make"

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Tampilkan semua pesan"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Lewati pemanggilan Kompilator"

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Opsi khusus Target OS"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr ""

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (beragam)"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Peringatan: file konfig kompilator tambahan mempunyai nama sama, seperti salah satu dari nama file konfig standar yang dicari kompilator FreePascal. Ini bisa berhasil HANYA penguraian konfig tambahan dan melewatkan konfig standar."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Buka Paket %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Buka Unit %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Buat proyek dulu!"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr ""

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr ""

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr ""

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr ""

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Buat proyek baru"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr ""

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Pilih Direktori"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Nilai Direktori CodeTools"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Definisikan template"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<tidak ada variabel dipilih>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Buka Peninjauan"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Piranti"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variabel: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nama Variabel"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Template"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "silahkan pilih makro"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Pilih Makro Kode"

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr ""

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Kolom kursor dalam editor saat ini"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Baris kursor dalam editor saat ini"

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr ""

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "opsi kustom"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opsi Kustom"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Program Kustom"

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#, fuzzy
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Program Kustom%sProgram freepascal"

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr ""

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Tanggal"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Hapus"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Hapus"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Debugger tidak ditetapkan"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Tetap set titikpisah"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Tidak ada debugger ditetapkan.%sSeting titikpisah tidak berpengaruh sampai anda menyiapkan Debugger dalam opsi dialog debugger dalam menu."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Kesalahan Debugger"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Kesalahan Debugger%sOoops, debugger masuk ke keadaan salah%sSimpan pekerjaan anda sekarang !%sTekan Hentikan, dan harapan terbaik, kami mencabut colokan."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger tidak benar"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (debugging ...)"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Tambahan path pencarian"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Titik pisah"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "bersihkan log saat dijalankan"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opsi umum Debugger"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opsi spesifik Debugger (tergantung pada tipe dari debugger)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Log Event"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Ditangani oleh"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Ditangani oleh Debugger"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Ditangani oleh Program"

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Abaikan eksepsi ini"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Eksepsi Bahasa"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Batasi hitungan baris ke"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Nama"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Eksepsi OS"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Output"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Proses"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Jalankan lagi"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Jalankan lagi yang Ditangani"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Jalankan lagi yang Tidak ditangani"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Tampilkan pesan saat berhenti"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Sinyal"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Jendela"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Tidak bisa mengambil file"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Tidak bisa mengambil file %s%s%s."

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr ""

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr ""

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr ""

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr ""

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr ""

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr ""

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Hapus semua file ini?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Hapus file yang tidak jelas?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr ""

#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Penghapusan file gagal"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr ""

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Hapus file lama %s%s%s?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr ""

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr ""

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr ""

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Penghapusan file %s%s%s gagal."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr ""

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr ""

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Proyek Delphi"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr ""

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Sudah ada komponen lain dengan nama %s%s%s."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Direktori Tujuan"

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Direktori tujuan %s%s%s tidak benar.%sSilahkan pilih path lengkap."

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr ""

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Huruf Diabaikan"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Abaikan jika baris kosong saat ditambahkan atau dihapus"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Abaikan perbedaan dalam akhir baris (contoh. #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Abaikan besar dari karakter spasi"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Abaikan spasi (karakter baris baru tidak disertakan)."

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Abaikan spasi diakhir baris"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Abaikan spasi diawal baris"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Hanya pilihan"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Buka Diff dalam editor"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Teks1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Teks2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr ""

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktif"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr ""

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr ""

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr ""

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr ""

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr ""

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr ""

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Abaikan perubahan"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "File yang berubah:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klik pada salah satu item diatas untuk melihat perbedaan"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Kesalahan pembacaan file: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Abaikan perubahan disk"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Ambil lagi dari disk"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Beberapa file telah berubah pada disk:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Bedakan huruf besar dan kecil contoh A dan a"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editor Dokumentasi"

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr ""

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Jangan tutup IDE"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Jangan tutup proyek"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr ""

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr ""

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Jangan tampilkan layar splash"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr ""

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr ""

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copy komponen yang dipilih ke clipboard"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Potong komponen yang dipilih ke clipboard"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Pindahkan komponen selangkah kebelakang"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Pindahkan komponen selangkah kedepan"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Pindahkan komponen ke belakang"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Pindahkan komponen ke depan"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Paste komponen yang dipilih dari clipboard"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Pilih komponen leluhurnya"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr ""

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Duplikasi nama: Komponen bernama %s%s%ssudah ada dalam komponen inherited %s"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr ""

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Pilih Skema"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Semua paket"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Proyek Saat Ini"

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Direktori Proyek Saat Ini"

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "tambahan Path Sumber Global"

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "IncPath Proyek"

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "SrcPath Proyek"

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "UnitPath Proyek"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Semua proyek"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "set mode  FPC ke DELPHI"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "set mode FPC ke GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr ""

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "set mode FPC ke TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "set IOCHECKS on"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "set OVERFLOWCHECKS on"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "set RANGECHECKS on"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "gunakan unit HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "gunakan unit LineInfo"

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Piranti yang benar membutuhkan setidaknya judul dan nama file."

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Edit Piranti"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr ""

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Insert"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Kunci"

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Makro"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parameters:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Namafileprogram:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Pindai output untuk pesan Kompilator Free Pascal"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Pindai output untuk pesan make"

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Dibutuhkan Nama file dan Judul"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Direktori Kerja:"

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr ""

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr ""

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr ""

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr ""

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr ""

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr ""

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr ""

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr ""

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr ""

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr ""

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr ""

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr ""

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Hidupkan"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr ""

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Hidupkan makro"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Sertakan"

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr ""

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr ""

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Masukkan bahasa terjemahan"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr ""

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr ""

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Direktori tidak ditemukan"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Direktori sumber \"%s\" tidak ditemukan."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Nama file kompilator tidak benar"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "File kompilator \"%s\" bukan eksekutabel."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nama file debugger tidak benar"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "File debugger \"%s\" bukan eksekutabel."

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#, fuzzy
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Direktori sumber FPC \"%s\" nampaknya tidak benar. Biasanya ia berisi direktori seperti rtl, packages, compiler, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Direktori Lazarus \"%s\" sepertinya tidak benar. Biasanya berisi direktori seperti lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Nama file make tidak benar"

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "File make \"%s\" bukan eksekutabel."

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Direktori Lazarus \"%s\" tidak ditemukan."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Direktori Tes \"%s\" tidak ditemukan."

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "CATATAN: hanya path absolut yang sekarang didukung"

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Panjang Tab"

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Opsi tidak benar di posisi %d: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Opsi di posisi %d tidak membolehkan argumen: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Salah:"

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Kesalahan pembuatan file"

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Kesalahan pembuatan lrs"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Kesalahan penghapusan file"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Kesalahan dalam %s"

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Kesalahan menginisialisasi program%s%s%s%s%sKesalahan: %s"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Kesalahan pemindahan komponen"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Kesalahan pemindahan komponen %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr ""

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr ""

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Pemindaian aliran komponen lfm salah."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Pembacaan daftar paket salah dari file %s%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr ""

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Kesalahan penggantian nama file"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Salah"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Kesalahan penulisan daftar paket ke file%s%s%s%s"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr ""

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr ""

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr ""

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr ""

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr ""

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Contoh"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr ""

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr ""

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Filter Kekecualian"

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr ""

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Mengeksekusi perintah setelah"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Mengeksekusi perintah sebelum"

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Eksekusi diistirahatkan"

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Eksekusi diistirahatkan%s  Alamat: $%s%s  Prosedur: %s%s  File: %s%s(Suatu hari jendela assembler mungkin muncul disini :)%s"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Eksekusi dihentikan"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr ""

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Lebarkan semua kelas"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Lebarkan semua paket"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Lebarkan semua unit"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nama file lebar dari file editor saat ini"

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Ekspor ..."

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Daftar ekspor"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr ""

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Lebarkan path unit?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Ekstrak"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr ""

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Piranti eksternal"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Gagal untuk menjalankan piranti"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Piranti Maksimum tercapai"

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Turun"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Naik"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Hapus"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Terdapat jumlah maksimum %s piranti."

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr ""

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Tidak bisa menjalankan piranti %s%s%s:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr ""

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Kurangi penggambaran pendesain"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Gambar item pendesain hanya saat menganggur (mengurangi kelebihan beban untuk komputer lambat)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "File %s%s%s%ssepertinya bukan file teks.%sBuka saja?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "File %s%s%s%ssepertinya bukan file teks.%sBuka saja?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr ""

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr ""

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr ""

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr ""

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "File tidak bisa diulisi"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr ""

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "File %s%s%s adalah virtual."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr ""

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr ""

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "File tidak ditemukan"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "File %s%s%s tidak ditemukan.%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "File %s%s%s tidak ditemukan.%sAnda ingin membuatnya?%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "File tidak dengan huruf kecil"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "File bukan teks"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr ""

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr ""

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr ""

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "file, dimana output debug ditulisnya. Jika tidak ditetapkan, output debug ditulis ke konsol"

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filter"

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr ""

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr ""

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr ""

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Opsi direktori"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "File mask (*;*.*;*.bak?)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Sertakan sub direktori"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr ""

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Hanya file teks"

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr ""

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Teks yang dicari:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Dimana"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr ""

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr ""

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr ""

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr ""

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Betulkan file LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr ""

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Paksa penggantian nama"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr ""

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Format salah"

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Pengambilan form salah"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr ""

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Komponen"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr ""

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Direktori Sumber FPC salah"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr ""

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr ""

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr ""

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr ""

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Cari komponen palet"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr ""

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr ""

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr ""

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Kompilator Free Pascal tidak ditemukan"

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#, fuzzy
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "program freepascal menggunakan TCustomApplication untuk memudahkan memeriksa opsi baris perintah, penanganan eksepsi, dll. File program secara otomatis dipelihara oleh lazarus."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "direktori sumber Freepascal"

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "File sumber FreePascal"

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Sumber Free Pascal tidak ditemukan"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr ""

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "File tambahan yang dicari (contoh /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Cari atau Ganti nama Pengenal"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Cari Referensi"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Pengenal: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "dalam semua paket dan proyek terbuka"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "dalam unit saat ini"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "dalam proyek utama"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "dalam proyek/paket pemilik unit saat ini"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Pengenal tidak benar"

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Ganti nama"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Ganti nama semua Referensi"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Ganti nama ke"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Cari dalam komentar juga"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Cari dimana"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr ""

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr ""

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr ""

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Pergi ke baris sumber yang dipilih"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr ""

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr ""

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr ""

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Komentar header untuk class"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr ""

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Selektor Panduan"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr ""

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Bantuan untuk pesan Kompilator FreePascal"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr ""

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr ""

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Buka"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr ""

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Jalankan"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr ""

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Simpan semua"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Melangkah kedalam"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr ""

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Melewati"

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Hentikan"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Petunjuk:  Fungsi Buat Resourcestring mengharapkan konstan string.%sSilahkan pilih ekspresi dan coba lagi."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Petunjuk: Fungsi Make Resourcestring mengharapkan konstan string. %sSiliahkan pilih hanya ekspresi string dan coba lagi."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Toggle Form/Unit"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Lihat Form"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Lihat Unit"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Database"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opsi Panduan"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Properti:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Peninjauan"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Path FPC Doc HTML"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horisontal"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr ""

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "Antarmuka IDE"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr ""

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Pengenal dimulai dengan ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Pengenal berisi ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opsi IDE"

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr ""

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Kesalahan mengakses xml"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Kesalahan mengakses file xml %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Kesalahan mengambil xml"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Kesalahan mengambil file xml %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "File ekspor sudah ada"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "File ekspor %s%s%s sudah ada.%sBuka file dan hanya timpa opsi kompilator?%s(Seting lain akan disimpan.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Ambil dari file"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Buka atau Ambil Opsi Kompilator"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Buka yang terbaru"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "File Terbaru"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Simpan ke file"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Simpan ke terbaru"

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr ""

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr ""

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Abaikan biner"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr ""

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Abaikan file hilang"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Abaikan, gunakan TForm sebagai leluhur"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr ""

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr ""

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Daftar impor"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr ""

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Filter Include"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "path include"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Sertakan path"

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr ""

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr ""

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr ""

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr ""

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr ""

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr ""

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr ""

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Baris:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Batalkan"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr ""

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr ""

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr ""

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr ""

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informasi tentang %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr ""

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr ""

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr ""

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr ""

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr ""

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr ""

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Sisipkan Makro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr ""

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr ""

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr ""

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr ""

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr ""

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr ""

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr ""

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr ""

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr ""

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr ""

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Instalasi gagal"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Pilihan Instalasi"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr ""

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr ""

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr ""

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr ""

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Perintah tidak benar"

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr ""

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Penghapusan tidak benar"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Direktori tujuan tidak benar"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ekspresi tidak benar.%sPetunjuk: Fungsi Make Resourcestring mengharapkan konstan string dalam file tunggal. Silahkan pilih ekspresi dan coba lagi."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr ""

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Direktori sumber Free Pascal tidak benar"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Pemilihan multi tidak benar"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr ""

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr ""

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Pengenal Pascal Tidak Benar"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Nama \"%s\" bukan pengenal pascal yang benar."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "nama proc tidak benar"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nama file proyek tidak benar"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr ""

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Pilihan tidak benar"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr ""

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s sudah merupakan bagian dari Proyek."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%sbukan nama proyek yang benar.%sSilahkan pilih yang lain (contoh. project1.lpi)"

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr ""

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr ""

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "Formulir JIT"

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr ""

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Biarkan nama"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Biarkan mereka dan lanjutkan"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Perintah Kustom"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Perintah Desainer"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Perintah Inspektor Objek"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr ""

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Batalkan pembuatan"

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Tambah unit aktif ke proyek"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Tambah pengawasan"

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Bangun seluruh file proyek/program"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Bangun proyek/program"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr ""

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasik"

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Tutup Semua"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Tutup proyek"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr ""

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Opsi CodeTools"

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Opsi Kompilator"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Konfig %sBuild File%s"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Konfigurasi komponen kustom"

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Konfigurasi Bantuan"

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#, fuzzy
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Konfigurasi paket terinstalasi"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Bantuan sensitif konteks"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Ubah paket Delphi ke paket Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Ubah proyek Delphi ke proyek Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Ubah unit Delphi ke unit Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Ubah file DFM ke LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Copy Komponen yang dipilih ke clipboard"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Cut Komponen yang dipilih ke clipboard"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Hapus karakter terakhir"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "File editor Diff"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Edit Template Kode"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Edit Bantuan sensitif konteks"

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Opsi Editor"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Tutupi pilihan"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evaluasi/Ubah"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Seting Piranti Eksternal"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Cari inkremental"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Pergi ke penanda 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Pergi ke penanda 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Pergi ke penanda 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Pergi ke penanda 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Pergi ke penanda 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Pergi ke penanda 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Pergi ke penanda 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Pergi ke penanda 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Pergi ke penanda 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Pergi ke penanda 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Pergi ke editor sumber 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Pergi ke editor sumber 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Pergi ke editor sumber 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Pergi ke editor sumber 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Pergi ke editor sumber 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Pergi ke editor sumber 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Pergi ke editor sumber 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Pergi ke editor sumber 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Pergi ke editor sumber 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Pergi ke editor sumber 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Sisipkan tanggal dan jam"

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Sisipkan $IFDEF"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Sisipkan nama pengguna"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspeksi"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Skema Pemetaan tombol"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr ""

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr ""

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr ""

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr ""

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Proyek baru"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Proyek baru dari file"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr ""

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr ""

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Buka file paket"

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "Grafik Paket"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Paste Komponen dari clipboard"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Istirahatkan program"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Terbitkan proyek"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr ""

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Hapus unit aktif dari proyek"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Jalankan program"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Simpan Semua"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "SimpanS ebagai"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Simpan proyek"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Simpan proyek sebagai"

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Pilih akhir baris"

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Pilih awal baris"

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Pilih bawah halaman"

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Pilih atas halaman"

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Pilih kata ke kiri"

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Pilih kata ke kanan"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Setel Bookmark bebas"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Set penanda 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Set penanda 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Set penanda 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Set penanda 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Set penanda 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Set penanda 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Set penanda 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Set penanda 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Set penanda 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Set penanda 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Hentikan program"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Toggle antara Unit dan Form"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr ""

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Togglel ihat Breakpoints"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Toggle lihat Call Stack"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Toggle lihat Explorer Kode"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Toggle lihat palet komponen"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Toggle lihat Output Debugger"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Toggle lihat Editor Dokumentasi"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Toggle lihat tombol cepat IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Toggle lihat Variabel Lokal"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Toggle lihat Pesan"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Toggle lihat Inspektor Obyek"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Toggle lihat Hasil Pencarian"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Toggle lihat Editor Sumber"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Toggle lihat Pengawasan"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Lihat histori lompat"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Lihat opsi proyek"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Lihat sumber proyek"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Lihat Info Unit"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Menjalankan aplikasi tidak benar"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Menjalankan baris perintah target"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Seting Desktop Lazarus"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Direktori Lazarus"

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Direktori Lazarus tidak ditemukan"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr ""

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr ""

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "File Lazarus"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Form Lazarus"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "File include Lazarus"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID bahasa Lazarus  (contoh. en, de, id, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nama bahasa Lazarus (contoh english, dutsch)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opsi] <namafile-proyek>"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Paket Lazarus"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Proyek Lazarus"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "File Info Proyek Lazarus"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Sumber proyek Lazarus"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Unit Lazarus"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr ""

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr ""

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr ""

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Tambah"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Opsi Pembangunan Lanjutan"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Bangun"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Bangun CodeTools"

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr ""

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Bangun IDE"

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Bangun JITForm"

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Bangun SynEdit"

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Bersihkan semua"

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Bersihkan+Bangun"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr ""

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr ""

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Kesalahan penulisan file"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr ""

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Tidak ada"

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "Ok"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opsi:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr ""

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr ""

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Segarkan"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Hapus"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Ganti nama"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr ""

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Simpan seting"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Target CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr ""

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Target OS:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr ""

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr ""

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Path unit LCL tidak ada"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Tipe Widget LCL"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr ""

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copy dari inherited"

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr ""

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Pindahkan entri ke inherited"

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr ""

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr ""

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Biarkan kosong untuk default file .po"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Left"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Batas spasi Kiri. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikiri kontrol."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Anchor Kiri"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Ini adalah kontrol terdekat dimana sisi kiri dianchor. Biarkan kosong untuk parent."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Sisi Kiri"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Kiri spasi secara sama"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Tingkat"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "File LFM"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "File LFM rusak"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr ""

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#, fuzzy
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Librari%sLibrari freepascal (.dll pada windows, .so pada linux, .dylib pada macosx). File sumber librari otomatis dipelihara oleh Lazarus."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "path pustaka"

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr ""

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr ""

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr ""

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "opsi penggabung"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr ""

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr ""

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr ""

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Nama"

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Nilai"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr ""

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr ""

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr ""

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr ""

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr ""

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr ""

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Masukkan data"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Masukkan parameter menjalankan"

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr ""

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Unit Utama mempunyai pernyataan Application.CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Unit Utama mempunyai pernyataan Application.Title"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Unit Utama mempunyai Seksi Uses yang berisi semua Unit dari proyek"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr ""

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Buat Eksekutabel"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make tidak ditemukan"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Buat ResourceString"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Tambahkan ke bagian"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Resourcestring %s%s%s sudah ada.%sSilahkan pilih nama lain.%sGunakan Abaikan untuk tetap menambahkan juga."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opsi Konversi"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Pengenal Kustom:"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Pengenal"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Panjang Pengenal:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefiks Pengenal:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Sisipkan secara alfabetik"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Sisipkan sensitif konteks"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Bagian ResourceString tidak benar"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr ""

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring sudah ada"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Bagian Resourcestring:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Peninjauan Sumber"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Konstan String dalam sumber"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "String dengan nilai sama:"

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr ""

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr ""

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Batalkan Pembangunan"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Sumber breakpoint"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Tambah breakpoint"

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Tambah unit aktif ke paket"

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Tambah titik lompatan ke histori"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Tambah file editor ke Proyek"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Tambah pengawasan ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr ""

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Bangun"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Bangun semua"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Bangun File"

#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "Bangun Lazarus"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr ""

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Periksa file LFM dalam editor"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Bersihkan direktori ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Tutup"

#: lazarusidestrconsts.lismenucloseall
#, fuzzy
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Tutup semua file editor"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Tutuip Proyek"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Editor definisi CodeTools ..."

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Kumpulkan file .po"

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Komentari pilihan"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Opsi Kompilator ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Kode Lengkap"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Sisipkan $IFDEF..."

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Konfigurasi Pembangunan+Jalankan File ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Konfigurasi komponen kustom ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr ""

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Konfigurasi \"Bangun Lazarus\" ..."

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Konfigurasi Panduan ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Panduan sensitif isi"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Konversi paket Delphi ke paket Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Konversi proyek Delphi ke proyek Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Konversi unit Delphi ke unit Lazarus ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Konversi file DFM ke LFM ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr ""

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Copy"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr ""

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Buat file .po"

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Cut"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Jendela Debug"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Diff"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Edit"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Template kode ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Edit Bantuan sensitif konteks"

#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Konfigurasi paket terinstalasi ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr ""

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Buat Submenu"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Hapus Dari Template..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Hapus Item"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr ""

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Sisipkan Dari Template..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Sisipkan Item baru (setelah)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Sisipkan Item Baru (sebelum)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor Menu"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Turun (atau kanan)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Naik (atau kiri)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Deskripsi Template Baru..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Simpan Sebagai Template..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Pilih Menu:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Pilih Template:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Peninjauan Template"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Tutupi pilihan ..."

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Li&ngkungan"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Evaluasi/Ubah ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Ekstraks prosedur ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&File"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Cari"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr ""

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Cari akhir blok kode lainnya"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Cari awal blok kode"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Cari Deklarasi di kursor"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Cari Referensi Pengenal ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Cari &dalam file ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Cari Berikut&nya"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Cari &Sebelumnya"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr ""

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr ""

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Pergi ke direktif include"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Pergi ke baris ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Tebak IFDEF/ENDIF salah tempat"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Tebak blok tidak tertutup"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Panduan"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr ""

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Pencarian inkremental"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Lekukan pilihan"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Entri ChangeLog"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Sisipkan dari Peta Karakter"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "kata kunci CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Tanggal dan waktu saat ini"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Umum"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "catatan GPL"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "catatan LGPL"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr ""

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Sisipkan teks"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Nama pemakai saat ini"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Inspeksi ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Lompat kembali"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Lompat maju"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Lompat ke"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Lompat ke penunjuk berikutnya"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Lompat ke kesalahan berikutnya"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Lompat ke penunjuk sebelumnya"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Lompat ke kesalahan sebelumnya"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Kecilkan huruf pilihan"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Buat String Resource ..."

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Form Baru"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Baru ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr ""

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Proyek Baru ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Proyek Baru dari file ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Unit Baru"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Panduan Online"

#: lazarusidestrconsts.lismenuopen
#, fuzzy
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Buka ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Buka nama file di kursor"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Buka paket yang diambil ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Buka file paket (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Open paket dari unit saat ini"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Buka Proyek ..."

#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Buka yang Terakhir ..."

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Buka paket terbaru ..."

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Buka Proyek Terakhir ..."

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr ""

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Paket Grafik ..."

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr ""

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Paste"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Istirahat"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr " ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Proyek"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspektor Proyek"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opsi Proyek ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Jalankan"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publikasikan Proyek ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Kompilasi Cepat"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Pemeriksaan sintaks cepat"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr ""

#: lazarusidestrconsts.lismenuquit
#, fuzzy
#| msgid "Quit"
msgid "&Quit"
msgstr "Keluar"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Redo"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Hapus dari Proyek ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Ganti nama Pengenal ..."

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Ganti"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr ""

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "Melaporkan bug..."

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Cari lagi direktori sumber FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Reset debugger"

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Mulai lagi"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Kembalikan"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "&Jalankan"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Jalankan File"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Parameter Menjalankan ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Jalanjan sampai kursor"

#: lazarusidestrconsts.lismenusave
#, fuzzy
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Simpan"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Simpan Semua"

#: lazarusidestrconsts.lismenusaveas
#, fuzzy
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Simpan Sebagai ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Simpan Proyek"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Simpan Proyek Sebagai ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Cari"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Pilih"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Pilih semua"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Pilih blok kode"

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Pilih baris"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Pilih paragraf"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Pilih untuk dikurung"

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Pilih kata"

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Set penunjuk bebas"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr ""

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Urut pilihan ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Melangkah ke dalam"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr ""

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Melewati"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Hentikan"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tab ke spasi dalam pilihan"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Tentang"

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Tutup"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Isi"

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Copy"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Cut"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Menu Edit Standar"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Menu File Standar"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Menu Panduan Standar"

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Edit"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Keluar"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "File"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Cari"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Cari Berikutnya"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Panduan"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Baru"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Buka"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Buka yang Terakhir"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Paste"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Redo"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Simpan"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Simpan Sebagai"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr ""

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr ""

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Piranti"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Jangan komentari pilihan"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Undo"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Jangan lekukan pilihan"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Besarkan huruf pilihan"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Lihat"

#: lazarusidestrconsts.lismenuviewanchoreditor
#, fuzzy
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Lihat Editor Jangkar"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr ""

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "BreakPoints"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Tumpukan Panggilan"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Browser Kode"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Eksplorer Kode"

#: lazarusidestrconsts.lismenuviewcomponentpalette
#, fuzzy
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Lihat Palet Komponen"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponen"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Log Event"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Output Debug"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Forms..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Lihat tombol cepat IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "Lihat Histori-Lompatan ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Variabel Lokal"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Pesan"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspektor Obyek"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr ""

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Cari Hasil"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr ""

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor Sumber"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Daftar ToDo"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Toggle tampilan form/unit"

#: lazarusidestrconsts.lismenuviewunitdependencies
#, fuzzy
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Lihat Ketergantungan Unit"

#: lazarusidestrconsts.lismenuviewunitinfo
#, fuzzy
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Lihat Informasi Unit"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Units..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Pengawasan"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr ""

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr ""

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr ""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Event Hilang"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr ""

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Paket Tidak Ada"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr ""

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr ""

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr ""

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr ""

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr ""

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sHak Cipta (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr ""

#: lazarusidestrconsts.lismore
msgid "More"
msgstr ""

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr ""

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr ""

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Simpan pesan ke file (*.txt)"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr ""

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nama dari procedure baru"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr ""

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr ""

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Karuhun Baru"

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr ""

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Kelas Baru"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr ""

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Buat program baru."

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Buat file editor baru.%sPilih jenis."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Buat file teks kosong baru."

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#, fuzzy
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Buat aplikasi grafis baru.%sFile program dipelihara olelh Lazarus."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Buat unit pascal baru"

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#, fuzzy
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Buat program baru.%sFile program diperlihara oleh Lazarus."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Buat proyek baru.%Pilih jenis."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Buat paket standar baru.%Paket adalah koleksi dari unit dan komponen."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Buat unit baru dengan modul data."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr ""

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Buat unit baru dengan form LCL."

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr ""

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Tidak ada item dipilih"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Silahkan pilih item terlebih dulu."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr ""

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr ""

#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "%s - (proyek baru)"

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr ""

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr ""

#: lazarusidestrconsts.lisno
msgid "No"
msgstr ""

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Tidak ada file backup"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Tidak ada perubahan"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Tidak ada kode dipilih"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Tidak ada opsi kompilator diturunkan."

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr ""

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr ""

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr ""

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr ""

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "tanpa nama"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%snone"

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "tidak ada"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr ""

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr ""

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr ""

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "ResourceString Section tidak ditemukan"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Biasanya filter adalah ekspresi reguler. Dalam Sintaks Sederhana sebuah . adalah  karakter normal, sebuah * bisa berarti apapun, sebuah ? berarti setiap karakter, dan koma serta titk koma memisahkan alternatif. Sebagai contoh: Sintaks Sederhana *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Tidak ada Konstan String Ditemukan"

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Bukan proyek Delphi"

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Bukan unit Delphi"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr ""

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "CATATAN: Tidak bisa membuat  Define Template untuk Sumber Free Pascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "CATATAN: Tidak bisa membuat  Define Template untuk Sumber Lazarus"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr ""

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr ""

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr ""

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Tdak sekarang"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Buat"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Buat proyek baru"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Pilih tipe proyek"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr ""

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr ""

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "path objek"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr ""

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr ""

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr ""

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Tambah properti favorit"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Pilih dasar kelas untuk properti favorit %s%s%s."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Class %s%s%s tidak ditemukan."

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Hapus dari properti favorit"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "otomatis menginstalasi dinamis"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "otomatis menginstalasi statis"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Deskripsi:  "

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sDeskripsi:  %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Nama file: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "diinstalasi dinamis"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "diinstalasi statis"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "tidak ada"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "diubah"

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Tidak ada paket yang dipilih"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Buka paket yang diambil"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nama Paket"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Silahkan pilih paket"

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Silahkan pilih paket yang dibuka"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "hanya baca"

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Kondisi"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sPaket ini diinstalasi, tetapi file lpk tidak ditemukan"

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sPaket ini otomatis dibuat"

#: lazarusidestrconsts.lisok
#, fuzzy
#| msgid "&Ok"
msgid "&OK"
msgstr "&Ok"

#: lazarusidestrconsts.lisold
msgid "old"
msgstr ""

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Karuhun Lama"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Kelas Lama"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr ""

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr ""

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Hanya mencari seluruh kata"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr ""

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr ""

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Buka sebagai file XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr ""

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Buka file yang ada"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Buka file"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr ""

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Buka %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Buka Paket?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr ""

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Buka File Paket"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Buka Proyek?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Buka proyek"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Buka lagi proyek"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Buka File Proyek"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr ""

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr ""

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Buka file sebagai sumber normal"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Buka paket %s?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Buka proyek %s?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "atau"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Timpa bahasa. Sebagai contoh  --language=de. untuk nilai yang mungkin lihat file dalam direktori languages."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr ""

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Timpa file?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Timpa file pada disk"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paket"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr ""

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Info Paket"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Nama paket dimulai dengan ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Nama paket berisi ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Paket perlu diinstalasi"

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Paket yang diinstalasi dalam IDE"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr ""

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "File sumber Pascal"

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Unit Pascal"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr ""

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr ""

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr ""

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr ""

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Browse"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Turunkan path"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Naikkan path"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Template Path"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Path Pencarian:"

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Pilih direktori"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr ""

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr ""

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Tambah item"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr ""

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Terapkan perubahan"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Panggil %sRegister%s procedure dari unit yang dipilih"

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Kompilasi"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Kompilasi semuanya?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Kompilasi paket"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opsi Kompilator untuk Paket %s"

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Opsi Kompilator"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Buat Makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr ""

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr ""

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Edit Opsi Umum"

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Opsi edit untuk kompilasi paket"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Properti File"

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Opsi Umum"

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Panduan"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalasi"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Instalasi paket dalam IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versi maksimum tidak benar"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versi minimum tidak benar"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versi Maksimum:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versi Minimum:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Diubah: %s"

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Selengkapnya ..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Turunkan dependensi"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Naikkan dependensi"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Paket %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Paket %s%s%s sudah diubah.%sSimpan paket?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "paket %s tidak dismpan"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Halaman: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Tambah-Ulang dependensi"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Tambah-Ulang file"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Hanya Baca: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Kompilasi ulang semua yang dibutuhkan"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Kompilasi ulang bersih"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Rekompilasi ini dan semua paket yang dibutuhkan?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Plugins terdaftar"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Register unit"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Hapus dependensi"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Hapus Dependensi?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Hapus dependensi %s%s%s%sdari paket %s%s%s?"

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Hapus File (entri ini tidak disimpan ke file lpk)"

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Hapus paket yang diperlukan (entri ini tidak disimpan ke file lpk)"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Hapus file"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Hapus file?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Hapus file %s%s%s%sdari paket %s%s%s?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Hapus item yang dipilih"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Paket yang Dibutuhkan"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Simpan Perubahan?"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Simpan paket"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr ""

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Versi maksimum  %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Versi minimum %s%s%s bukan versi paket yang benar.%s(contoh benar 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Uninstalasi"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Lihat Sumber Paket"

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "AutoCreated"

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Diinstalasi"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalasi saat mulai nanti"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Paket yang dipilih dibutuhkan oleh:"

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Paket yang Diambil:"

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Paket %s tidak ditemukan"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sKondisi: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Jangan instalasi saat mulai nanti"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Tambah opsi untuk paket dependen dan proyek"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Tambah path ke paket dependen/proyek"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Pembuat:"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Otomatis menaikan versi pada buatan"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Otomatis membangun ulang jika diperlukan"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Otomatis membangun ulang ketika pembangunan ulang semua"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Kustom"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Deskripsi/Abstrak"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Waktu desain dan Runtime"

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Hanya waktu desain"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integrasi IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipe paket tidak benar"

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr ""

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Librari"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Lisensi:"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Mayor"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Kompilasi manual (tidak secara otomatis)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minor"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objek"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opsi Paket"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "TipePaket"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Menyediakan"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Rilis"

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Hanya Runtime"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Paket %s%s%s mempunyai tanda otomatis instalasi.%sIni berarti akan diinstalasi dalam IDE. Paket instalasi%sharus Paket waktu desain."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Paket ini menyediakan hal yang sama seperti paket berikut:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Pemutakhiran/Bangun ulang"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Penggunaan"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Batalkan"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progres"

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr ""

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Konflik ditemukan"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr ""

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nama file:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr ""

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nama file unit tidak benar"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nama unit tidak benar"

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr ""

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr ""

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr ""

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr ""

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr ""

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr ""

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nama unit:"

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr ""

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Tambahan CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Direktori output"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Tanda Direktori Sumber Proyek"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Path Unit"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Anda benar-benar ingin melupakan semua perubahan terhadap paket %s dan mengambil ulang dari file?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Unit baru tidak dalam unitpath"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publikasikan Paket"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Kembalikan paket?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "File %s%s%s%ssaat ini tidak dalam unitpath dari paket.%s%sTambah %s%s%s ke UnitPath?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Panduan Online belum diimplementasikan"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Klik kanan pada susunan item untuk mendapatkan menu popup dengan semua fungsi paket yang tersedia"

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Ada fungsi lebih banyak dalam menu popup"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Biner"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "File Include"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Teks form Lazarus"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus resource"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr ""

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Teks"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unit Virtual"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sPenambahan Dependensi baru untuk paket %s: paket %s%s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sPenambahan Dependensi baru untuk proyek %s: paket %s%s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Tambah unit ke klausul uses dari paket. Matikan ini hanya untuk unit yang seharusnya tidak dikompilasi dalam semua kasus."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unit dwimakna ditemukan"

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Paket yang dibutuhkan tidak ditemukan. Lihat grafik paket."

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Otomatis menginstalasi paket"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sKedua paket tersambung. Ini berarti, This means, either one package uses the other, or they are both used by a third package."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dependensi Rusak"

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Berputar dalam dependensi paket"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Penghapusan gagal"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Hapus File Paket Lama?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Hapus file paket %s%s%s?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Dependensi tapa Pemilik: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Kesalahan pembacaan file"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Kesalahan Pembacaan Paket"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Kesalahan penulisan file"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Kesalahan Penulisan Paket"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "File sudah ada dalam paket"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "File dalam Proyek"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nama file berbeda dari Namapaket"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nama file sedang digunakan oleh paket lain"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nama file sedang digunakan oleh proyek"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "File %s%s%s tidak ditemukan."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "File tidak disimpan"

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Abaikan dan simpan paket sekarang"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Menginstalasi paket %s akan menginstalasi paket secara otomatis:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Nama file Kompilator tidak benar"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Ekstensi file tidak benar"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ekstensi file paket tidak benar"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nama file paket tidak benar"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nama paket tidak benar"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nama Paket Tidak Benar"

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Pengambilan paket %s akan menimpa paket %s%sdari file %s.%sPaket lama diubah.%s%sSimpan paket lama %s?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "PaketBaru"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Paket: %s"

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Paket %s%s%s diubah. Simpan?"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Paket konflik"

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "File Paket hilang"

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr ""

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Paket %s%s%s tidak mempunyai direktori output yang benar:%s%s%s%s"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Paket bukan paket waktu desain"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Paket dibutuhkan"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "file sumber utama paket"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Nama paket sudah ada"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Paket harus mempunyai ekstensi .lpk"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Silahkan simpan file sebelum menambahkannya ke paket."

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Silahkan simpan terlebih dulu."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Proyek: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Bangun ulang Lazarus?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Ganti nama file dalam paket?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr ""

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Timpa file yang sudah ada %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Timpa File"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Simpan Paket?"

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Simpan paket?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Simpan Paket %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Haruskah file diganti nama huruf kecil ke %s%s%s%s?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Lewati paket ini"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "file konfigurasi paket statik"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "File kompilator  untuk paket %s bukan eksekutabel yang benar: %s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "File %s%s%s%ssudah berada dalam paket %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "File %s%s%s ibukan paket Lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Nama file %s%s%s tidak terkait ke nama paket %s%s%s dalam file.%sUbah nama paket ke %s%s%s?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Nama file %s%s%s adalah bagian dari proyek saat ini.%sProyek dan Paket seharusnya bukan file berbagi."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Nama file %s%s%s digunakan oleh%spaket %s%s%s%sdalam file %s%s%s."

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "File %s%s%s%sdari paket %s hilang."

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "File %s%s%s%sdari paket %s perlu disimpan lebih dulu."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Paket berikut gagal diambil:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Paket berikut gagal diambil:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sUnit berikut akan ditambahkan ke bagian uses dari%s%s:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Paket %s%s%s gagal dikompilasi.%sHapus dari daftar instalasi?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Nama file paket %s%s%s in%s%s%s%s bukan nama paket Lazarus yang benar."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Paket %s adalah hanya paket runtime.%sPaket hanya runtime tidak bisa diinstalasi dalam IDE."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Paket %s%s%s ditandai untuk instalasi, tetapi tidak ditemukan.%sHapus dependensi dari daftar instalasi paket?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Paket %s diperlukan oleh %s, yang ditandai untuk instalasi.%sLihat grafik paket."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Nama paket %s%s%s bukan nama paket yang benar%sSilahkan pilih nama lain (contoh. paket1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Nama paket %s%s%s dari%sfile %s%s%s tidak benar."

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Paket %s memiliki file%s%s%s%s.%sHaruskah file diganti nama didalam paket juga?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Paket %s%s%s sudah ditandai.%sSaat ini Lazarus hanya mendukung paket static linked. Pembatalan instalasi sebenarnya perlu membangun ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Paket %s%s%s  ditandai untuk instalasi.%sSaat ini Lazarus hanya mendukung paket static linked. Instalasi sebenarnya memerlukan pembangunan ulang dan memulai lagi Lazarus.%s%sAnda ingin membangun ulang Lazarus sekarang?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Proyek memerlukan paket %s%s%s.%sTetapi tidak ditemukan. Lihat Proyek -> Inspektor Proyek."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Ada dua unit dengan nama sama:%s%s1. %s%s%s dari %s%s2. %s%s%s dari %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Ada lingkaran dalam paket yang diperlukan. Lihat grafik paket."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Ada unit  FPC dengan nama yang sama dengan paket::%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Ada unit FPC dengan nama yang sama dengan: %s%s%s%s%s dari %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Sudah ada nama paket lain dengan nama %s%s%s.%sPaket konflik: %s%s%s%sFile: %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Sudah ada paket %s%s%s diambil%sdari file %s%s%s.%sLihat Komponen -> Grafik Paket.%sPenimpaan tidak mungkin."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Ada paket tidak disimpan dalam paket yang diperlukan. Lihat grafik paket."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Ada unit dengan nama yang sama dengan paket:%s%s1. %s%s%s dari %s%s2. %s%s%s%s"

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Ini adalah paket virtual. belum mempunyai sumber. Silahkan simpan paket terlebih dulu."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Tidak bisa membuat direktori"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Tidak bisa membuat direktori output %s%s%s%suntuk paket %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Tidak bisa membuat direktori sumber paket %s%s%s%suntuk paket %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Tidak bisa membuat direktori target untuk lazarus:%s%s%s%s.%sDirektori ini dibutuhkan untuk Lazarus IDE baru yang diubah dengan paket kustom anda."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Tidak bisa menghapus file %s%s%s."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Tidak bisa menghapus file"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Tidak bisa menghapus file kondisi yang lama %s%s%s%suntuk paket %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr ""

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Tidak bisa membuka paket %s%s%s.%sPaket ini ditandai untuk instalasi."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Tidak bisa membaca file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Tidak bisa menulis paket %s%s%s%ske file %s%s%s.%sKesalahan: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Tidak bisa menulis file kondisi %s%s%s%sdari paket %s.%sKesalahan: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Batalkan instalasi paket?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Batalkan instalasi paket %s?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Paket tidak disimpan"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Gunakan unit"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Perhatian: File %s%s%s%smilik proyek saat ini."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "Registrasi Paket"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Tidak bisa mendaftarkan komponen tanpa unit"

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools -  piranti dan fungsi untuk mengurai, melihat dan mengedit sumber pascal"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Kelas Komponen %s%s%s sudah didefinisikan"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNama File: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Kelas komponen tidak benar"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Nama unit tidak benar: %s"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "File paket tidak ditemukan"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Register procedure kosong"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit dipanggil, tetapi tidak ada paket yang terdaftar."

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Registrasi Salah"

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - komponen editor yang digunakan oleh Lazarus. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "FCL - FreePascal Component Library menyediakan dasar kelas untuk objek pascal."

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "LCL - Lazarus Component Library berisi semua dasar komponen untuk pengeditan form."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Paket ini %s%s%s diinstalasi, tetapi tanpa file paket (.lpk) yang ditemukan.%spaket sementara yang rusak dibuat."

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "RTL - Run-Tima Library adalah dasar dari semua program Free Pascal."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Ini adalah paket default. Digunakan hanya untuk komponen tanpa paket. Komponen ini kadaluarsa."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Paket diinstalasi, tetapi file lpk tidak ditemukan. Semua komponennya di-non aktifkan. Silahkan betulkan ini."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNama Unit: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Unit tidak ditemukan: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Unit %s%s%s sudah dihapus dari paket"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "File tidak dalam paket yang diaktifkan."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Tidak bisa membaca file paket %s%s%s.%sKesalahan: %s"

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr ""

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr ""

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr ""

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr ""

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr ""

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr ""

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr ""

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Silahkan buka unit sebelum menjalankan"

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr ""

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Silahkan pilih beberapa kode untuk mengekstrak procedure/method baru."

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Semua>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Ubah Font"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copy nama method ke clipboard"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filter menyamai setiap bagian dari method"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filter menyamai setiap awal dari method"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Lompat Ke Pilihan"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Tidak ada>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objects"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr ""

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipe"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ""

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Jangan simpan info sesi apapun"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr ""

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Simpan dalam direktori konfigurasi IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Simpan dalam file .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Simpan dalam file .lps dalam direktori proyek"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Simpan informasi sesi dalam"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr ""

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "direktori konfigurasi utama, dimana Lazarus menyimpan file konfigurasinya. Default adalah"

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Cetak"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Metode Private"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Mungkin anda perlu menginstalasi beberapa paket sebelum melanjutkan. %s%sPerhatian:%sProyek tergantung pada beberapa paket, yang berisi unit dengan prosedur Register. Prosedur Register biasanya digunakan untuk menginstalasi komponen dalam IDE. Tetapi unit berikut milik paket yang belum diinstalasi dalam IDE. Jika anda ingin mencoba membuka form dalam IDE, yang menggunakan komponen tersebut, anda akan mendapatkan kesalahan mengenai komponen yang tidak ada dan pengambilan form akan membuat hasil yang tidak menyenangkan.%s%sIni tidak berpengaruh pada pembukaan proyek atau sumbernya.%s%sIni hanya berarti: Adalah ide yang buruk untuk membuka form untuk desain, sebelum menginstalasi paket yang tidak ada.%s%s"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedure"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Proseduir dengan interface"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#, fuzzy
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Program%sProgram freepascal. File program otomatis dipelihara oleh lazarus."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program dideteksi"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Sumber program harus ekstensi pascal seperti .pas, .pp or .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr ""

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Tambah file ke proyek:"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Dependensi sudah ada"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Tambah file editor"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Tambah file"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versi Min-Max tidak benar"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Namapaket tidak benar"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Nama unit pascal tidak benar"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versi tidak benar"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versi Maksimum (opsional):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versi Minimum (opsional):"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Kebutuhan Baru"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nama Paket:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paket tidak ditemukan"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Dependensi %s%s%s tidak ditemukan.%sSilahkan pilih paket yang ada."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Versi Maksimum %s%s%s tidak benar.%sSilahkan gunakan format mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Versi Maksimum lebih rendah daripada Versi Minimum."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Versi Minimum %s%s%s tidak benar.%sSilahkan gunakan format mayor mayor.minor.rilis.buatan%sSebagai contoh: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Nama paket %s%s%s tidak benar.%sSilahkan pilih paket yang ada."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Proyek sudah mempunyai dependensi untuk paket %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Nama unit %s%s%s sudah ada dalam proyek%sdengan file: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Nama unit %s%s%s sudah ada dalam pilihan%sdengan file: %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Nama unit %s%s%s bukan pengenal pascal yang benar."

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Tambah ke proyek"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Nama unit sudah ada"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Prouek diubah"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr ""

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Direktori proyek"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nama file proyek"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Path Include Proyek"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "File info proyek dideteksi"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Informasi Proyek"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Proyek bisa dijalankan"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Properti makro proyek"

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "makro ProjectUnitPath"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr ""

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr ""

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr ""

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Path Src Proyek"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#, fuzzy
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Proyek %s%s%s dibangun dengan sukses. :)"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr ""

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Path Unir Proyek"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr ""

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Konfirmasi penghapusan dependensi"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr ""

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Hapus dependensi untuk %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspektor Proyek - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Hapus paket yang diperlukan"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Hapus file %s dari proyek?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Tidak bisa membaca file kondisi %s dari proyek %s%sKesalahan: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Tidak bisa menuliskan file kondisi untuk proyek %s%sKesalahanr: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Selalu membangun (meskipun jika tidak ada yang berubah)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Salah"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Tidak bisas mengubah form otomatis dibuat dalam sumber program.%Silahkan betulkan kesalahan terlebih dahulu."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Tanda Direktori Sumber Proyek"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Nilai untuk prompt"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr ""

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Metode Protected"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Metode Public"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Metode Published"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Direktori publikasi proyek"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Filter Exclude tidak benar"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Filter Include tidak benar"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ""

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Unit pascal harus mempunyai ekstensi .pp atau .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Edit unit virtual"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Sudah ada unit dengan nama ini.%sFile: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Nama unit bukan pengenal pascal yang benar."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Nama unit digunakan ketika IDE melebarkan klausul uses."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Namam unit dan nama file tidak sama.%sContoh: unit1.pas dan Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr ""

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr ""

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr ""

#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Buka yang Terakhir"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr ""

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr ""

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Keluar Lazarus"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Pembacaan Salah"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr ""

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr ""

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Nama"

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Nilai"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr ""

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Path relatif"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr ""

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Hapus semua properti yang tidak benar"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr ""

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Hapus dari proyek"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr ""

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr ""

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr ""

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr ""

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Hapus mereka"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr ""

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Ganti nama file?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Penggantian nama file gagal"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Ganti nama ke huruf kecil"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr ""

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr ""

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr ""

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr ""

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Penggantian yang dipilih gagal."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr ""

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr ""

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Kesalahan pengambilan resource"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Penyimpanan resource salah"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr ""

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr ""

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr ""

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr ""

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr ""

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Pengembalian gagal"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Right"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Anchor Kanan"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Batas spasi Kanan. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi dikanan kontrol."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Ini adalah kontrol terdekat dimana sisi kanan dianchor. Biarkan kosong untuk parent."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Sisi Kanan"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Kanan spasi secara sama"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr ""

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "File bukan eksekutabel"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Aplikasi induk %s%s%s bukan eksekutabel."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Jalankan-sampai gagal"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr ""

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr ""

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr ""

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr ""

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr ""

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr ""

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr ""

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr ""

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr ""

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr ""

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr ""

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr ""

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr ""

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Simpan ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Simpan semua pesan ke file"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "simpan semua file yang diubah"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Dialog Simpan dan keluar"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Simpan dan bangun ulang IDE"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Simpan perubahan?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Simpan perubahan ke proyek %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "simpan file editor saat ini"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Simpan info editor dari file non proyek"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Simpan file sebagai"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Simpan file %s%s%s%ssebelum menutup form %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Simpan info dari file editor yang ditutup"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr ""

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Simpan Seting"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Simpan"

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Faktor Skala:"

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Mencari"

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr ""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "direktori konfig kedua, dimana Lazarus mencari file template konfig. Default adalah"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Lihat pesan."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sLihat Proyek -> Inspektor Proyek"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Pilih item panduan:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Pilih node"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Pilih form Delphi dari file (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr ""

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr ""

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr ""

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Pilihan melebih konstan string"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Piranti pemilihan"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr ""

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr ""

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr ""

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr ""

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr ""

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr ""

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr ""

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr ""

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr ""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr ""

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr ""

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Tampilkan petunjuk dalam Inspektor Objek"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Tampilkan pengenal"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr ""

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Tampilkan urutan tab lama"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Tampilkan paket"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr ""

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr ""

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Tampilkan unit"

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr ""

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr ""

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr ""

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Terdekat"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Sintaks Sederhana"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr ""

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Lewati file dan lanjutkan pengambilan"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Lewati pengambilan proyek terakhir"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr ""

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Sama"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr ""

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Maaf, tipe ini belum diimplementasikan"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Membesar"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Batal"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr ""

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Mengecil"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domain"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Abaikan Spasi"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Baris"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opsi"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragraf"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Peninjauan"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Terima"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Urut pilihan"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Kata"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Sumber dan Tujuan adalah sama:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr ""

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr ""

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Direktori sumber %s%s%s tidak ada."

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Sumber dimodifikasi"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Sumber dari halaman %s%s%s sudah diubah. Simpan?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Path sumber"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Spasi secara sama"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr ""

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Pencarian"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Cari teks"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr ""

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Mulai dengan proyek baru"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Hentikan debugging saat ini dan bangun ulang proyek?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Hentikan Debugging?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Hentikan debugging?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr ""

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Hentikan debugging?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr ""

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr ""

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Pengaliran salah"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr ""

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr ""

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub Prosedur"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub Prosedur pada tingkat yang sama"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sukses"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revisi SVN:"

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nama variabel tidak benar"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s bukan pengenal yang benar."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Timpa variabel sistem"

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr ""

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Urutan Tab dari"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Target CPU"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nama file target dari proyek"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr ""

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Target OS"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Kesalahan kompilator internal! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ""

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Direktori Tes"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr ""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Class %s%s%s adalah TControl dan tidak bisa di-paste ke dalam non kontrol.%sTidak mem-paste."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Perintah seteleh %s%s%s bukan eksekutabel."

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Perintah setelah publikasi tidak benar:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr ""

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Editor komponen dari class%s%s%s%sditemukan dengan verb #%s %s%s%s%stelah menghasilkan kesalahan:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr ""

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr ""

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr ""

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Nama file kompilator saat ini %s%s%sbukan eksekutabel yang benar.%sPilih Ok untuk memilih %s%s%s default.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Nama file kompilator saat ini %s%s%s%sbukan eksekutable yang benar.%sSilahkan periksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Direktori sumber Free Pascal saat ini %s%s%stidak benar.%sPilih Ok untuk memilih default %s%s%s.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Direktori sumber Free Pascal saat ini %s%s%s%stidak benar.%sPeriksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Direktori Lazarus saat ini  %s%s%s%stidak benar.%sTanpa itu Anda tidak akan bisa membuat aplikasi LCL.%sPilih Ok untuk memilih default %s%s%s.%sSebaliknya periksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Direktori Lazarus saat ini %s%s%s%stidak benar.%sTanpa itu Anda tidak akan bisa membuat aplikasi LCL.%sPeriksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Path unit saat ini untuk file%s%s%s%s is%s%s%s%s.%s%sPath ke unit LCL %s%s%s tidak ada.%s%sPeunjuk untuk pemula:%sBuat aplikasi lazarus dan tempatkan file ke dalam direktori proyek."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Debugger %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Lingkungan -> Opsi Debugger"

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Direktori tujuan %s%s%s%s tidak ada."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr ""

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Direktori %s%s%s tidak dibutuhkan lagi dalam path unit.%sHapus?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr ""

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Direktori %s%s%s belum ada dalam path unit.%sTambahkan?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr ""

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "File %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr ""

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr ""

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "File %s%s%s bukan proyek Delphi (.dpr)"

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "File %s%s%s bukan unit Delphi."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr ""

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "File %s%s%s%ssepertinya sebuah program. Tutup proyek sekarang dan buat proyek Lazarus baru untuk program ini?%s\"Tidak\" akan mengambil file sebagai sumber normal."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "File %s nampaknya file program dari Proyek Lazarus yang sudah ada."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr ""

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "File %s%s%s%stidak ditemukan.%sAnda ingin mencarinya sendiri?%s"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "File %s%s%s%stidak ditemukan. %sMengabaikan akan tetap mengambil proyek, %sMembatalkan akan menghentikan pengambilan."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Method berikut digunakan oleh %s tidak dalam sumber%s%s%s%s%s%sHapus referensi dangling?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Kompilator Free Pascal (nama file: %s) tidak ditemukan. %sDirekomendasikan anda menginstalasi fpc."

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Direktori sumber Free Pascal tidak ditemukan.%sBeberapa fungsi kode tidak akan bekerja.%sDirekomendasikan anda menginstalasinya dan men-set path%sLingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr ""

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr ""

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr ""

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr ""

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Menjalankan aplikasi %s%s%s%stidak ada atau bukan yang bisa dijalankan.%s%sLihat Jalankan -> Parameter menjalankan -> Lokal"

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Direktori Lazarus tidak ditemukan.%sAnda tidak akan bisa membuat aplikasi LCL.%sSilahkan periksa Lingkungan -> Opsi Lingkungan -> File"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "File LFM (form Lazarus) berisi properti tidak benar. Ini berarti sebagai contoh berisi beberapa properti/kelas, yang tidak ada dalam LCL saat ini. Pembetulan normal adalah menghapus properti ini dari lfm dan membetulkan kode pascal secara manual."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Nama %s%s%s bukan pengenal pascal yang benar."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr ""

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr ""

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr ""

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr ""

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr ""

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Program %smake%stidak ditemukan.%sPiranti ini diperlukan untuk membangun lazarus.%s"

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr ""

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "File info proyek %s%s%s%ssama dengan file sumber utama proyek!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr ""

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Proyek harus disimpan sebelum pembangunan%sJika anda menset Direktori Test dalam opsi lingkungan,%sanda bisa membuat proyek baru dan membangunnya sekaligus.%sSimpan proyek?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr ""

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr ""

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Ada file lain dalam direktori dengan nama yang sama, %syang beda hanya jenis hurufnya:%s%s%sHapus dulu?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Ada file dengan nama sama dan ekstensi mirip pada disk%File: %s%s%sHapus file dwimakna?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr ""

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Sudah ada form dengan nama %s%s%s"

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Sudah ada unit dengan nama%s%s%s. Pengenal Pascal harus unik."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Ada unit dengan nama %s%s%s dalam proyek.%sSilahkan pilih nama yang berbeda"

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Resource class %s%s%s turunan dari %s%s%s. Mungkin ini salah ketik untuk TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Ada kesalahan selama penulisan komponen yang dipilih %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Ada kesalahan ketika pengubahan stream biner dari komponen yang dipilih %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Ada kesalahan ketikda meng-copy stream komponen ke clipboard:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Komponen teratas tidak bisa dihapus."

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr ""

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr ""

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr ""

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Unit %s%s%s sudah ada.%sAbaikan akan memaksa penggantian nama,%sBatal akan membatalkan penyimpanan sumber ini dan%sGugurkan akan membatalkan semua penyimpanan."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr ""

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr ""

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr ""

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr ""

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr ""

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Unit sendiri sudah mempunyai nama %s%s%s. Pengenal Pascal harus unik."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr ""

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr ""

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr ""

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "pesan panduan ini"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Ini sepertinya file pascal. %s direkomendasikan untuk menggunakan nama file dengan huruf kecil, untuk menghindari berbagai masalah pada beberapa filesystems dan kompilator berbeda. %sGanti nama ke huruf kecil?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr ""

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Pernyataan ini tidak bisa diekstrak.%sSilahkan pilih beberapa kode untuk mengekstrak procedure/method baru."

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr ""

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr ""

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr ""

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr ""

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr ""

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr ""

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Fungsi: tambah delimiter path"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Fungsi: chomp delimiter path"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Fungsi: ekstrak ekstensi file"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Fungsi: ekstrak nama+ekstensi file"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Fungsi: ekstrak hanya nama file"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Fungsi: ekstrak path file"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(makro tidak dikenal: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Path:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr ""

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr ""

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr ""

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Anchor Atas"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Batas spasi Atas. Nilai ini ditambahkan ke batas spasi dasar dan digunakan untuk spasi diatas kontrol."

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Atas"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Ini adalah kontrol terdekat dimana sisi atas dianchor. Biarkan kosong untuk parent."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Spasi Atas secara sama"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr ""

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr ""

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Jangan tampilkan pesan ini lagi."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Kesalahan dalam ekspresi reguler"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Font tanpa  UTF-8"

#: lazarusidestrconsts.lisuegotoline
#, fuzzy
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Pergi ke baris :"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr ""

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Tidak ditemukan"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Ganti %s%s%s%s yang ditemukan ini dengan %s%s%s?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Pencarian: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Pencarian string '%s' tidak ditemukan!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Font editor saat ini tidak mendukung UTF-8, tetapi sistem anda nampak menggunakannya. %sItu berarti karakter non ASCII mungkin akan ditampilk tidak benar. %sAnda bisa memilih font lain dalam opsi editor."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Bersihkan cache include"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s byte"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Clear"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Disertakan oleh:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "dalam Proyek:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Baris:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nama:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "tidak"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "Ok"

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Path (Hanya Baca)"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Ukuran:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Src"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "TipeL"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "ya"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Tampilkan Nilai CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Tidak bisas mengubah stream biner ke teks"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Tidak bisa meng-copy komponen ke clipboard"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Tidak bisa menambah komentar header resource ke file resource %s%s%s%s.%sKemungkinan salah sintaks"

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Tidak bisa menambah resource T%s:FORMDATA ke file resource %s%s%s%s.%sKemungkinan salah sintaks."

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr ""

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Tidak bisa menambah %s ke proyek, karena sudah ada unit dengan nama yang sama dalam Proyek."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Tidak bisa mem-backup file %s%s%s to %s%s%s!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sTidak bisa mengubah kelas dari %s ke %s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Tidak bisa membersihkan direktori tujuan"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Tidak bisa membersihkan %s%s%s.%sSilahkan periksa perijinan."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Tidak bisa mengkonversi teks komponen ke dalam format biner:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Tidak bisa mengubah file %s%s%s%sKesalahan: %s"

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Tidak bisa mengubah lfm ke lrs dan menulis file lrs"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Tidak bisa mengubah data form teks dari file %s%s%s%s%skedalam aliran biner. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Tidak bisa meng-copy file"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Tidak bisa meng- copy file %s%s%s%sto %s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Tidak bisa meng-copy file %s%s%s%sto %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Tidak bisa membuat direktori backup %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Tidak bisa membuat direktori %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Tidak bisa membuat direktori %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Tidak bisa membuat file"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Tidak bisa membuat file %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Tidak bisa membuat file %s%s%s."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Tidak bisa membuat metode baru. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Tidak bisa membuat bufer lfm sementara."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr ""

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Tidak bisa menghapus file dwimakna %s%s%s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr ""

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Tidak menemukan nama class yang benar dalam %s%s%s"

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Tidak bisa menemukan file %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr ""

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Tidak bisa menemukan %s dalam LFM Stream."

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Tidak bisa menemukan metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Tidak bisa mencari unit kelas komponen %s%s%s."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Tidak bisa mengumpulkan perubahan editor."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Tidak bisa mendapatkan sumber untuk desainer."

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Tidak bisa mengambil file resource. %sFile resource adalah file include pertama dalam %sbagian inisialisasi. %sSebagai contoh {$I %s.lrs} %sKemungkinan kesalahan sintaks."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Tidak bisa mengambil kelas komponen %s%s%s, karena ia tergantung pada dirinya sendiri."

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr ""

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Tidak bisa membuka desainer.%sKelas %s bukan turunan dari kelas bisa didesain seperti TForm atau TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr ""

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Tidak bisa membaca file"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Tidak bisa membaca file %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Tidak bisa membaca file %s%s%s%sKesalahan: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Tidak bisa membaca file %s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr ""

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Tidak bisa menghapus file backup lama %s%s%s!"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Tidak bisa mengganti nama file dwimakna %s%s%s%ske %s%s%s"

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Tidak bisa mengganti nama file"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Tidak bisa mengganti nama file %s%s%s to %s%s%s!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Tidak bisa mengganti nama file %s%s%s%sto %s%s%s."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Tidak bisa mengganti nama form dalam sumber."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Tidak bisa mengganti nama metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Tidak bisa mengganti nama variabel dalam sumber."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr ""

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Tidak bisa menyimpan file %s%s%s"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Tidak bisa men-set Kontrol AnchorSide"

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Tidak bisa menampilkan metode. Silahkan betulkan kesalahan yang ditampilkan dalam jendela pesan."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Tidak bisas menyalurkan komponen yang dipilih"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Tidak bisa mengalirkan komponen yang dipilih."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Tidak bisa mengalirkan %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Tidak bisa mentransformasi aliran komponen biner %s:T%s ke dalam teks"

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Tidak bisa memutakhirkan pernyataan CreateForm dalam sumber proyek"

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr ""

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Tidak bisa menulis %s%s%s%s%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Tidak bisa menuliskan file"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Tidak bisa menulis file %s%s%s%sKesalahan: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Tidak bisa menulis ke file %s%s%s!"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr ""

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr ""

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Deinstalasi pilihan"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr ""

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Pengenal unit sudah ada"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr ""

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nama unit sudah ada dalam proyek"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Nama unit dimulai dengan ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Nama unit berisi ..."

#: lazarusidestrconsts.lisunitnotfound
#, fuzzy
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Unit tidak ditemukan"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Direktori Output Unit"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "path unit"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Path Unit"

#: lazarusidestrconsts.lisunitsnotfound2
#, fuzzy
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Unit tidak ditemukan"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr ""

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr ""

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr ""

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr ""

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr ""

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr ""

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr ""

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Gunakan Filter Kekecualian"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr ""

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr ""

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Gunakan Filter Include"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Meluncurkan aplikasi"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr ""

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr ""

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr ""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr ""

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr ""

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr ""

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr ""

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr ""

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr ""

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr ""

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versi"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertikal"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr ""

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr ""

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Lihat Unit Proyek"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Lihat Sumber (.lfm)"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr ""

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr ""

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Peringatan: file dwimakna ditemukan: %s%s%s. File Sumber adalah: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr ""

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr ""

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr ""

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr ""

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Dengan paket yang diperlukan"

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "T&ambah"

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Hapus"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "&Hapus Semua"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Mat&ikan Semua"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "Hidupka&n Semua"

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Dihidupkan"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Ekspresi"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Properti"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Daftar Pengawasan"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Kata di kursor dalam editor saat ini"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Direktori kerja untuk membangun"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Direktori kerja untuk menjalankan"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Penulisan Salah"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr ""

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr ""

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "File XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Anda tidak bisa membangun lazarus saat debugging atau kompilasi."

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor Sumber"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr ""

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Tambah Inverse"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr ""

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr ""

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr ""

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr ""

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr ""

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Definisi kondisional"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Buat definisi baru"

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr ""

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr ""

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr ""

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr ""

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr ""

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Dari file data (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr ""

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr ""

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr ""

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr ""

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Posisi Kustom"

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Default"

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Menempel"

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Simpan kembali geometri jendela"

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Simpan kembali ukuran jendela"

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Gunakan seting windowmanager"

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Kunci"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Bahasa Arab"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Otomatis (atau Inggris)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalian"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Cina"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr ""

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Belanda"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Inggris"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finlandia"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Perancis"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Jerman"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebrew"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesian"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italia"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Jepang"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lithuania"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr ""

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polandia"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Portugis"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Rusia"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr ""

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr ""

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "SPanyol"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr ""

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukraina"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr ""

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr ""

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr ""

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr ""

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr ""

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Hapus"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr ""

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr ""

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr ""

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr ""

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr ""

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Nilai"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr ""

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "Kunci \"%s\" sudah terhubung ke \"%s\"."

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Kunci alternatif (atau 2 kunci kombinasi)"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Perintah menu Panduan"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Perintah Perintah"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Perintah CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr ""

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Perintah pemindahan kursor"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Perintah pengeditan teks"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Perintah menu Lingkungan"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Perintah menu File"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr ""

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Perintah penanda teks"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr ""

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Perintah menu Proyek"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Perintah menu Jalankan"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Perintah pencarian dan penggantian teks"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Perintah pemindahan teks"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Perintah Notebook Sumber"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr ""

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr ""

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Perintah menu Piranti"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Perintah menu Lihat"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Perintah:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr "    perintah1 \""

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr "    perintah2 \""

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflik"

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr "konflik dengan"

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "batalkan pembangunan"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Tambahkan titik lompat"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "tambah pengawasan"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Penyempurnaan template kode"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr ""

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Lekukan Blok"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr ""

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr ""

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr ""

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr ""

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Jangan lekukan blok"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "bangun program/proyek"

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "bangun semua file dari program/proyek"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "bangun file"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Bangun Lazarus"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Karakter"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Hapus seluruh teks"

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Editor definisi Codetools"

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Opsi Codetools"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr ""

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr ""

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr ""

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr ""

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr ""

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr ""

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Mode pemilihan kolom"

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "opsi kompilator"

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Lengkpai kode"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "file konfig pembangunan"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Copy pilihan ke clipboard"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Piranti Kustom %d"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Potong pilihan ke clipboard"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Hapus sampai awal baris"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Hapus karakter di kursor"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Hapus sampai akhir baris"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Hapus Karakter Terakhir"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Hapus sampai awal kata"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Hapus baris saat ini"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Hapus sampai akhir kata"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Pindahkan kursor ke absolut akhir"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Pindahkan kursor ke absolut awal"

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr ""

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "evaluasi/modifikasi"

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Ekstraks prosedur"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Piranti eksternal %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Seting piranti eksternal"

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Cari teks"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Cari akhir blok lain"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Cari awal blok"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Cari deklarasi"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Cari referensi pengenal"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Cari dalam file"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Cari berikutnya"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Cari keberadaan kata berikutnya"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr ""

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Cari sebelumnya"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Cari keberadaan kata sebelumnya"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Cari definisi procedure"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Cari metode procedure"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr ""

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Pergi ke editor %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Pergi ke direktif include dari file include saat ini"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Pergi ke nomor baris"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Pergi ke Penanda %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Pergi ke XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Tebak $IFDEF salah tempat"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Sisipkan entri ChangeLog"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Sisipkan dari Charactermap"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Sisipkan Pembuat kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Sisipkan Tanggal kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Sisipkan Header kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Sisipkan ID kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Sisipkan Log kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Sisipkan Nama kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Sisipkan Revisi kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Sisipkan Sumber kata kunci CVS"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Sisipkan tanggal dan waktu saat ini"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Sisipkan catatan GPL"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr ""

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Sisipkan catatan LGPL"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Pisahkan baris, biarkan kursor"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Mode Sisipan"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Sisipkan catatan LGPL yang diubah"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Sisipkan nama pemakai saat ini"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspeksi"

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Balikkan penempatan"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Pisahkan baris dan pindahkan kursor"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Pindahkan kursor ke akhir baris"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Mode pemilihan baris"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Pindahkan kursorke awal baris"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr ""

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Buat string resource"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Pergi ke kurung yang sama"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Pindahkan editor ke kiri"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr ""

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Pindahkan editor ke kanan"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr ""

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Penanda berikutnya"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Pergi ke editor berikutnya"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr ""

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Mode pilihan normal"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Buka file di kursor"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Mode Menimpa"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Pindahkan kursor ke bawah halaman"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Pindahkan kursor turun satu halaman"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Pindahkan kursor ke kiri satu halaman"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Pindahkan kursor ke kanan satu halaman"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Pindahkan kursor ke atas halaman"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Pindahkan kursor naik satu halaman"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Paste clipboard ke posisi saat ini"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pause program"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Penanda sebelumnya"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Pergi ke editor sebelumnya"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr ""

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr ""

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "kompilasi cepat, tanpa linking"

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr ""

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "hapus break point"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr ""

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr ""

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Ganti nama pengenal"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Ganti teks"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr ""

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "reset debugger"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "jalankan program"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "jalankan file"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parameter menjalankan"

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Simpan"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Gulung sebaris ke bawah"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Gulung satu karakter ke kiri"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Gulung satu karakter ke kanan"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Gulung sebaris ke atas"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Pilih Turun"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Pilih Semua"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Ubah tab ke spasi dalam pilihan"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Pilih ke absolut akhir"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Pilih ke absolut awal"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Pilih Pergi ke XY"

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "PilihKiri"

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Pilih Akhir Baris"

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Pilih Awal Baris"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr ""

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Pilih Halaman ke Bawah"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Pilih Halaman Turun"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Pilih Halaman ke Kiri"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Pilih Halaman ke Kanan"

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Pilih Halaman ke Atas"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Pilih Halaman Naik"

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "Pilih Kanan"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Pilih Naik"

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Pilih Sekata ke Kiri"

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Pilih Sekata ke Kanan"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr ""

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Set Penanda %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr ""

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Tampilkan konteks kode"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr ""

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "hentikan program"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr ""

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Pemeriksaan Sintaks"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr ""

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Lihat breakpoint"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Lihat pemanggilan stack"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Lihat browser kode"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Lihat Eksplorer Kode"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Lihat palet komponen"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Lihat output debugger"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Tukar antara form dan unit"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Lihat Editor Dokumentasi"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Lihat tombol cepat IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Lihat variabel lokal"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr ""

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr ""

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Lihat pesan"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Toggle Mode"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Lihat Inspektor Objek"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr ""

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr ""

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Lihat Hasil Pencarian"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Lihat Editor Sumber"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Lihat pengawasan"

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr ""

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr ""

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "perintah editor tidak dikenal"

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Pemakai Pertama"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Lihat editor anchor"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr ""

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Lihat form"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Lihat ketergantungan unit"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Lihat informasi unit"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Lihat unit"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Penyempurnaan kata"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Pindahkan kursor sekata ke kiri"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Pindahkan kursor sekata ke kanan"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr ""

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Edit Kunci"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Ambil kunci"

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Ambil kunci kedua"

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Tombol (atau 2 kombinasi tombol)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Silahkan tekan sebuah kunci ..."

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr ""

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr ""

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "File adalah hanya-baca"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "File \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" tidak bisa ditulisi."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr ""

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Tambah &Pengawasan Di Kursor"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Penunjuk"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr ""

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Tutup Halaman"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Kode Lengkap"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Copy"

#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Copy nama file"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to new Window"
msgstr ""

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr ""

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Cut"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Debug"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Properti Editor"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Tutup Pemilihan"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr ""

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr ""

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Ekstrak Procedure"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Cari Deklarasi"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Cari Referensi Pengenal"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "Per&gi ke penujuk"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr ""

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr ""

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Balikkan Penempatan"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr ""

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr ""

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr ""

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr ""

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr ""

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr ""

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr ""

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr ""

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr ""

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Pergi ke Penunjuk berikutnya"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Dimodifikasi"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Buka file di kursor"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Paste"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Pergi ke Penunjuk sebelumnya"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Procedure Lompat"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Hanya Baca"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Ganti nama Pengenal"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Jalankan ke Kursor"

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Set Penunjuk"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Set penunjuk bebas"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Tampilkan Niomor Baris"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Info Unit"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr ""

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr ""

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Lihat Panggilan Stack"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Belum Di Imlementasikan"

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Sudah saya bilang: Belum diimplementasikan"

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Jika anda bisa membantu kami untuk mengimplementasikan fitur ini, suratkan ke lazarus@miraclec.com"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Hanya-baca"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Info Versi"