lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.he.po

msgid ""
msgstr ""
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Mime-Version: 1.0Last-Translator: Ido Kanner <idokan@gmail.com>\n"
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2011-01-05 16:36+0300\n"
"Language-Team: American English <kde-i18n-doc@kde.org>\n"
"MIME-Version: 1.0\n"
"X-Generator: Lokalize 1.0\n"
"Plural-Forms: nplurals=2; plural=(n != 1);\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "השתמש בסכמה מוגדרת מראש"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "אתחל את כל ההגדרות"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "אתחל את כל הגדרות קווי העזר"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "אתחל את כל ההגדרות הטקסט"

#: lazarusidestrconsts.dlfmousesimplediff
#| msgid "This page does not represent your current settings. See advandced page. Use this page to reset any advanced changes"
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "דף זה לא מציג את הגדרותיך הנוכחיות. ראה דף - מתקדם. השתמש בדף זה כדי לאתחל איזה שהם שינויים מתקדמים"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "כללי"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr "סטנדרטי, כל הפעולות (נקודת עצירה, קיפול) כשלחצן העכבר לחוץ"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr "מורחב, פעולות (נקודת עצירה, קפול) כשלחצן העכבר למעלה.בחירה כשלחצן העכבר לחוץ והעכבר זז"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "קו עזר"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "עכבר ימני כולל תנועה מושמטת"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "טקסט"

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "לחצן Alt קובע את מצב העמודה"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr "לחצן שמאלי + Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr "קופץ אל המימוש"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr "קופץ אל המימוש/סיום של בלוק אחר"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr "כלום"

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr "לחיצה כפולה בוחרת שורה"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr "גרור לבחירה (העתק/הדבק)"

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr "קופץ אל המימוש"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "לחצן אמצעי"

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr "כלום"

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr "הדבק בחירה"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "יש לך שינויים לא שמורים. שימוש בעמוד זה יבטל את השינויים שנעשו בדף הבא"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "<כלום>"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "קריאה בלבד"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "אותיות קטנות, אות ראשונה למעלה"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "הוסף אופרטור הצבה :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "סוגריים מודגשים"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "עץ קוד מקופל"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "טקסט ברירת המחדל"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "בטל נקודת עצירה"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "הפעל נקודת עצירה"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "שורת שגיאה"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "נקודת הביצוע"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "סמן של קוד מקופל"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "גלובלי"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "קו עזר"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "שורה"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "עריכה מתוזמנת"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "עריכת תבנית"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "טקסט"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "קו עזר מפריד"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "הגדל אחרים"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "הדגש שורה נוכחית"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "חיפוש מתקדם"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "נקודת עצירה בלתי אפשרית"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "שורה נוכחית מודגשת"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "מספר שורה"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "שורה ששונתה"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "קישור לעכבר"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "אזור שנבחר"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "התא הפעיל"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "תאים אחרים"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "תאים מתוזמנים"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "התא הפעיל"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "תאים אחרים"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "תאים מתוזמנים"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "בלוק של טקסט"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "נקודת עצירה לא ידועה"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "סוגרי מילה"

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "נתיב חיפוש נוסף עבר קבצי קוד מקור לכל הפרויקטים (.pp;.pas)"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "הוסף נקודה פסיק"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "התאם את הקו העליון להערות בהתחלה"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "כל הקבצים"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "לפי סדר א' ב'"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "הסמן תמיד גלוי"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "פעולת קובץ רב משמעית:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "אזהרה בזמן הידור"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "הגדרות יישום"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "ברירת מחדל"

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "כלול קוד הפרה"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "צור טפסים אוטומטית:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "בזמן יצירת טפסים חדשים הוסף אותם לטפסים הנוצרים אוטומטית."

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "מחק קובץ אוטומטית"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "הסתר סמן עכבר בזמן הקלדה"

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "זיהוי אוטומטי"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr "(הפעל זיהוי חכם)"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "הסר אוטומטית מתודות ריקות"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "שנה אוטומטית שם קובץ לאותיות קטנות"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "שמור אוטומטית"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "טפסים זמינים"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "רקע"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(ללא תת ספרייה)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "שם זהה (בתיקיית משנה)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "מאחרי המתודות"

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr "בחירה:"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "זהות הבלוק"

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr "זהות המתודה"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "רווח/טאב כשורה קודמת"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "מיקום בלבד"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "רווחים"

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "תואם TP/BP 7.0"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "סוגריים מודגשים"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr "זוגות סוגריים תואמים"

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "קובץ הודעות מהדר free pascal (*.msg)|*.msg| קבצים כלשהם )*.*(|*.*"

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "יישם"

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "תלוי ברי&שיות"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "בודק את אפשרויות המהדר"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "תוצאות"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "בדיקה"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "בדיקה: בודק מהדר ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "בדיקה: בודק תצורת מהדר ..."

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "בדיקה: בודק תצורת מהדר fpc ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "בדיקה: בודק תאריך מהדר ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "בדיקה: מהדר קובץ ריק ..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "בדיקה: ppu חסר של fpc ..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "בדיקה: בודק מקורות בנתיבי החיפוש של ppu של  fpc  ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "בדיקה: מהדר קובץ ריק ..."

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "סדר המחלקות"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "אחרון"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "אותיות קטנות"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "תצוגה מקדימה (אורך שורה מקסימלי = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "קרא קידומת"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "סיומת מאוחסנת"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "אותיות רישיות"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "קידומת משתנה"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "קידומת כתיבה"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "מרכז את שורת הסמן"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "שמור כ - שנה אוטומטית שמות של קבצי פסקל לאותיות קטנות"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "בדוק עקביות"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "בדוק חבילות בזמן יצירת טופס"

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "בחר קובץ תבנית לקוד (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "מדיניות הכנסה של חלקי מחלקה"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "הראה את כפתור הסגירה בפנקס"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "סכמת צבעים"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "מקרו בסגנון שפת c (גלובלי)"

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "השתמש במחרוזת ansi"

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "כמו שהוא"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "סגנון אסמבלר:"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "הודעות"

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "בדיקות:"

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "הידור"

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr "מותנים"

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "אופרטורים בסגנון שפת c (=*,=+,=/,=-)"

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "צור צומת בת"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "צור makefile"

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "צור צומת מעל"

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "צור צומת מתחת"

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "צור מידע ניפוי שגיאות עבור DBX (מאט את ההידור)"

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "מנפה שגיאות:"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "תוספת נתיב למנפה השגיאות (none):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "יצירת קוד"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "שניהם"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "קפל"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "הסתר"

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "עכבר"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "הפוך סדר קיפול בתפריט קופץ"

#: lazarusidestrconsts.dlgcodegeneration
#| msgid "Code"
msgid "Code generation"
msgstr "יצירת קוד"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "אפשרויות CodeTools"

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "קוד מהיר יותר"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "צור מידע ניפוי שגיאות עבור GDB (מאט את ההידור)"

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "יוצר:"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "השתמש ביחידת heaptrc"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "כלול קבצים (-FI):"

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "מורש"

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "שמור משתנים מסויימים באוגרים"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "תיקיות (-FI):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "קישור"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "טען/שמור"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "צבע"

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "יצוא"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(ערוך צבע)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "לא השתנה"

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "פרמטרים של שורת הפקודה"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "פרמטרים של שורת הפקודה (ללא שם היישום)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr "זוז למטה"

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr "זוז רמה אחת למטה"

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr "זוז רמה אחת למעלה"

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr "זוז למעלה"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr "הודעות מהדר"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "קובץ שפת הודעות מהדר"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "אפשרויות מהדר"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "השלם מאפיינים"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "קבצי תצורה:"

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "קוד תקני"

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "אפשרויות: "

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "אחר"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "גלישה"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "מפרש"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "העתק/הדבק עם מידע קפול"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "העתק מילה בהעתקת כלום"

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "טווח"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "הראה שגיאות"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "הראה אפשרויות"

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "קוד קצר יותר"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "מיזוגיות חכמה"

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "מקורות אחרים ( קבצי pp/.pas.  בשימוש IDE בלבד ולא ע\"י המהדר)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "מחסנית"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "הסר סמלים מקובץ ריצה"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "סגנון היחידה:"

#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr "השתמש באפשרויות מהדר אלו כברירת מחדל לפרוייקט חדש"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "צור קוד עבור valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "קולניות"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "פנימי בסגנון ++C"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "מקש Ctrl+לחצן אמצעי על לשונית סוגר את כל הלשוניות האחרות"

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "סמן לאחר סיום השורה"

#: lazarusidestrconsts.dlgcursorgroupoptions
msgid "Cursor:"
msgstr "סמן:"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "הסמן מדלג על בחירה"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "סמן מדלג על טאבים"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "הרחבה של המשתמש (pp.xxx.)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "נתיב העורך"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "סוג מנפה השגיאות והנתיב אליו"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "גופן ברירת מחדל של העורך"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "ערך ברירת מחדל"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "הרחבות דלפי 2"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "מחק תבנית"

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "תואם דלפי"

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "שולחן עבודה"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "לחצנים -"

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "קבצי שולחן עבודה"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "טיפים"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "תפריטים -"

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "אפשרויות שונות"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "כיוון"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "תיקיה אינה קיימת"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "בטל החלקת תצוגה"

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "השתמש בצבע שוליים ימניים"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "שרטט רמת הפרדה"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "צבע שורה מקונן"

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr "שרטט מפריד"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "צבע שורה"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "התחלה/סוף"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "פרוצדורה/פונקציה"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "מחלקה/מבנה נתונים"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "מחלקה/מבנה נתונים (מקומי)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "נסה/קבל"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "קטעי יחידה"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "משתמש בפיסקה"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "משתנה/סוג"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "משתנה/סוג (מקומי)"

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "למטה"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "הוסף ..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "אחורה"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "מודגש"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "תת תיקייה"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "תבניות קוד"

#: lazarusidestrconsts.dlgedcolor
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "צבעים"

#: lazarusidestrconsts.dlgedcompleteblocks
#| msgid "Complete blocks"
msgid "Add close statement for pascal blocks"
msgstr "הוסף קוד סגירה לבלוקים של פסקל"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "הרחבה מוגדרת ע\"י המשתמש"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "השהיה"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(השהייה של s% שניות)"

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "מחק"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "הצג"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "עריכה ..."

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "קבצי עורך"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "השלמת מזהה"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "החלף"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "התעלם מנעילות, השתמש בעורך הארוך ביותר שאינו בשימוש"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "התעלם מנעילות, אם העורך הוא הנוכחי"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "התעלם מנעילות, אם העורך נמצא בחלון הנוכחי"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "נעול, אם הטקסט מוצג"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "לא נעול"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "לא נעול, אם הטקסט ממורכז"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "לשונית חדשה, חלון קיים או חדש"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "לשונית חדשה בחלון חדש"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "לשונית חדשה בחלון קיים"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "אפשרות זאת תשתמש בעורך הארוך ביותר שאינו בשימוש בשביל הקובץ, אפילו אם הוא נעול ו/או צריך גלילה. ההחלטה על העורך הארוך ביותר לא מתחשבת בסדר המיקוד של החלונות,אפילו אם הוא מוגדר כ \"אותו קריטריון סדר\". אפשרות זאת תצליח תמיד,אפשרויות נוספות עדיין לא נוסו."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "אפשרות זאת תבדוק אם לעורך הפעיל הנוכחי יש את קובץ המטרה , ואם יש היא תשתמש בעורך הנוכחי, אפילו אם הוא נעול ו/או צריך לגלול."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "אפשרות זאת תבדוק אם יש עורך לקובץ המטרה בחלון הנוכחי , ואם יש היא תשתמש בעורך, אפילו אם הוא נעול ו/או צריך לגלול."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "אפשרות זאת תשתמש בעורך נעול (ונעול בלבד), אשר אינו צריך לגלול כדי להציג את המטרה של נקודת הקפיצה (המטרה של נקודת הקפיצה כבר נראית על המסך)"

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "אפשרות זאת תשתמש בעורך לא נעול כלשהו."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "אפשרות זאת תשתמש בעורך לא נעול, אשר אינו צריך לגלול כדי להציג את  המטרה של נקודת הקפיצה (המטרה של נקודת הקפיצה כבר נראית באזור מרכז המסך,חוץ מ 2-5 שורות בחלק העליון או התחתון של המסך."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "אפשרות זאת תפתח לשונית חדשה בחלון חדש או קיים, אם נמצאה לשונית לא נעולה. אפשרות זאת תעבוד תמיד,אפשרויות נוספות עדיין לא נוסו."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "אם לא נמצאה לשונית לא נעולה, אז אפשרות זאת תפתח לשונית חדשה בחלון חדש (אפילו אם אפשר להשתמש בחלון קיים אחר עבור הלשונית החדשה). אפשרות זאת תעבוד תמיד,אפשרויות נוספות עדיין לא נוסו."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "אם לא נמצאה לשונית לא נעולה, אז אפשרות זאת תפתח לשונית חדשה בחלון קיים  (ורק בחלון קיים). לשונית נפתחת אם קיים חלון, שעדיין אין לו עורך מתאים לקובץ המטרה."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "כתב נטוי"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "גופני עורך"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "גובה גופן העורך"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "אפשרויות עורך"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "סכמת משתנים גלובליים"

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "שונות"

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "לא נמצאו בעיות בעת מיפוי המקשים"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "כבוי"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "דלוק"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "קו תחתון"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "תכונות הפריט"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "מקש end קופץ לקצה הקרוב ביותר"

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "כל התחום"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "שאל"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "הערה: קבצי הפרויקט הם כל הקבצים הנמצאים בתיקיית הפרויקט"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "גבוי"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "צבעים"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "קבצים"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "רשת"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "שפה"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "קווים מנחים"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "שונות"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "ללא"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "קבצים אחרים"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "פרויקט"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "סוג"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "מקד הודעות אחרי הידור"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "מרווח תו מוגדל"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "מרווח שורה מוגדל"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "השתמש בקובץ סמלים חצוני של מנפה השגיאות gdb"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "הרחבות לקובץ"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "מצא טקסט במוקום הסמן"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "חלק"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "בחירת חתיכה"

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "קובץ"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "הערה"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "צומת"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "פריט"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "רשימה<>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "אובייקט (בירושה, פנימי)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "משתנה/סוג (מקומי)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "הערה  (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "התחלה/סיום (מקונן)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "הערה { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "מחלקה/עצם"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "צבורי/פרטי"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "קבל/לבסוף"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "הערה מקוננת"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "התחלה/סיום (של פרוצדורה)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "פרוצדורה"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "תוכנה"

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "רשומה"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "חזור"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "הערה //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "נסה"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "יחידה"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "קטע יחידה"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{אזור%}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "משתמש ב"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "משתנה/סוג (גלובלי)"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "הערה"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "סוג מסמך"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "צומת"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "הוראת עיבוד"

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "קידמה"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "מדיניות הזנת פרוצדורה"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "שמור על סדר הפרוצדורות"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "מיקום המהדר (למשל %s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "תיקיית קבצי המקור של FPC"

#: lazarusidestrconsts.dlgframecolor
#| msgid "Frame color"
msgid "Text-mark"
msgstr "צבע הטקסט"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "עורך טפסים"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "סמן טפסים"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "אפשרויות"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr "צור מידע מצומצם של ניםוי שגיאות"

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "השג את המיקום"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "גלובלי"

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "תואם ( GPC (GNU Pascal Compiler"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "צור קוד עבור gprof"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "לוכד צבע"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "צבע הרשת"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "גודל הרשת בכוון אופקי"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "רווח הרשת בכוון אופקי"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "גודל הרשת בכוון אנכי"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "רווח הרשת בכוון אנכי"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "CodeTools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "מנפה שגיאות"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "עורך"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "סביבה"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "עזרה"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "בטל קבוצה"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "הראה קווי עזר"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "קווי עזר"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "שקרס"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "צבע קווי עזר"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "צבע הגבול של קווי עזר"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "אידקס קווי עזר מפרידים"

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "רוחב קווי עזר"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "גלילת חצי דף"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "גודל הערמה"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "גובה:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "הסתר את חלונות ה IDE בזמן ריצה"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "הסתר את סמלי ההודעות"

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "הסתר לשונית בחלונות חד-עמודיים"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "צבע ההדגשה"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "צכע הגופן המודגש"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "שמאל הסמן"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "ימין הסמן"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "אל תראה טיפים של פרמטר \"sender\" שאינו בשימוש"

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "הראה טיפים עבור יחידות שאינן בשימוש בקובץ קוד המקור הראשי"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "מקש home קופץ להתחלה הקרובה ביותר"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "יישום מארח"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "השלמם מזהים"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "מדיניות מזהים"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "אפשרויות IDE"

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "התעלם"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "כלול משתני מערכת"

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "זהה קוד ל"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Indent and Tabs:"
msgstr "זיהוי ולשוניות:"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "לפני המתודות"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "שם הבונה חייב להיות init (שם ההורס חייב להיות 'done')"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "הכנס רווח אחרי"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "הכנס רווח לפני"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "מרווח זמן בשניות"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "קפיצה (למשל קפיצה למתודה)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "שמור על המיקום האופקי של הסמן"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "מפוי מקשים"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "שגיאת מפוי מקשים"

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "סכמת מפוי מקשים"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "מדיניות מלות-מפתח"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "אפשר LABEL ו GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "שפה"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "אחרון (כלומר בסוף קוד המקור)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "תיקיית לזארוס (ברירת מחדל לכל הפרויקטים)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "שמאל:"

#: lazarusidestrconsts.dlglefttopclr
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "קוים מנחים שמאל, למעלה"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "רמה 1 (מהיר ומנפה שגיאות ידידותי)"

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "רמה 2 (רמה 1 + אופטימיזציה מהירה)"

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "רמה 3 (רמה 2 + אופטימיזציה איטית)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "רמה 0 (ללא אופטימיזציה נוספת)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "פיצול שורה"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "סגנון קישור:"

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "קישור חכם"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "הצג מספרי שורות בסוגריים של שגיאות בזמן ריצה"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "טען הגדרות שולחן עבודה מקובץ"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "תפריט ראשי"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "צפה בטפסים בפרויקט"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "צפה במסגרות בפרויקט"

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "צפה ביחידות בפרויקט"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "נתיב ל Make"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "שוליים וקווי עזר"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "צבע הסמן"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr "הדגשת מילים תחת הסמן"

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "התאם את תוחמי המילה עד לאורך זה:"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr "התעלם ממילות-מפתח"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr "בטל טיימר עבור מלה נוכחית עליונה"

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr "צמצם רווחים (כאשר הבחירה הנוכחית מודגשת)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "מונה מקסימלי"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "אורך שורה מירבי:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "מספר מקסימלי של קבצים שנפתחו לאחרונה"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "מספר מקסימלי של קבצי פרוייקט שנפתחו לאחרונה"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "מדיניות הכנסת מתודות"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "ערבב מתודות ותכונות"

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "לחצן"

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "שמאל"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "אמצע"

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "ימין"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "קפל הכל (חלק מצומצמים)"

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "קפל אחד (חלק מצומצמים)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "פרוש הכל (חלק מצומצמים)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "פרוש אחד (חלק מצומצמים)"

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "מאופשר"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "קפל הכל (הכל פרוש)"

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "קפל אחד (הכל פרוש)"

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "הגדרות 1"

#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr "הגדרות 2"

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmousegroupoptions
msgid "Mouse:"
msgstr "עכבר:"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "יחיד"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr "כפול "

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr "משולש"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr "מרובע"

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "הוסף"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "כלשהו"

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "מחק"

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "למטה"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "יצוא"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr "תוספות 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr "תוספות 2"

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "יבוא"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "שמאל"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "אמצע"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "צור נתוני שחזור"

#: lazarusidestrconsts.dlgmouseoptbtnok
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "אישור"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "ימין"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "שנה"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "למעלה"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "תפוס"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "הזז סמן (נוסף)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "פעל כשהעכבר עולה"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "פעולה"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "קליק"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "ערוך עכבר"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "הכפל ערך"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "ערך זה נמצא בסתירה לערך קיים אחר"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "לחצן"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "סמן"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "הקשר"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "קליק"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "פעולה"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "למעלה/למטה"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "אפשרות"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "סדר"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "עדיפות"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "עכבר"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "מתקדם"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "פקודת IDE"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "קוו עזר"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "קפל עץ"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "מצומצם[+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "פרוש[-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "מספרי שורות"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "טקסט"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "בחירה"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "פעולה אחרת משתמשת באותו לחצן"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr "הם יכולים להתבצע כתלות במקשי השינוי, הגדרות שאריתיות, יחיד/כפול, למעלה/למטה..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "מקשי סינון"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "עדיפות"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "הודעות"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "בחירה מרובה"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr "מצא עורך למטרות הקפיצה:"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "סדר השימוש בעורכים המתאימים לאותו קריטריון"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "העורך שמוקד אחרון לקובץ זה"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "עורך (לקובץ) בחלון שמוקד אחרון"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "רשימת עדיפות לקריטריונים לבחירת עורך:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "עמודים וחלונות"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr "לשוניות פנקס:"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "מתן שם"

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "ללא מתן שמות אוטומטי"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "ללא הדגשה"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "מקור מיקום לשוניות הפנקס"

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "תחתית"

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "שמאל"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "ימין"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "פסגה"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "אל תחצה את השורה אחרי:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "אל תחצה את השורה לפני:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "מפקח עצמים"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "גובה הפריט"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "שונות"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "אפשרויות"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "הגדרות מהירות"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "השתמש בהגדרות המחדל של דלפי"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "השתמש בהגדרות המחדל של לזארוס"

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "מיטובים:"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "קבצי יחידה אחרים (-Fu) (המפריד הוא פסיק):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr "כתוב על הבלוק הקיים"

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr "גרף החבילות"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "טיפים ללוח הרכיבים"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "הרחבות ברירת מחדל של פסקל"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "הדגש משפטי בקרה כמילות מפתח"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr "פרוש את אפשרויות המקלדת של פסקל"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "העבר אפשרויות למקשר (המפריד הוא רווח)"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr "הדגש מחרוזת מילת/ות מפתח"

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "ברירת מחדל"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "ללא"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "רק \"מחרוזת\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr "בלוק מתמשך"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "סמן קבוע"

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "קבצות החבילות"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "יישום"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "נקה סמל"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "צור חבילת יישום"

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr "יישום שמודע לצפיפות הנקודות (עבור ויסטה)"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "טפסים"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "סמל:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(גודל: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(ללא)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "טען סמל"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "שונות"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "הוצא הגדרות"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "שמור סמל"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "הפעלה"

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "שם קובץ המטרה:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "כותרת:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "השתמש בחבורת היישום להרצה ולניפוי שגיאות (darwin בלבד)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "השתמש בקובץ הרשימות לאפשר ערכות נושא (חלונות בלבד)"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "אפשרויות פרויקט"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "אפשרויות לפרוייקט: s%"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "קבצי הפרויקט"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "שאל על הח&לפה"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "השלמת תכונות"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "שם התכונה"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "סגור אוטומטית את תיבת הדושיח של ההידור"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "פתח את הפרויקט האחרון בהתחלה"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "הראה את ריווחי הגבול"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "הראה את תיבת הדושיח של ההידור"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "הראה רשת"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "הצמד לקווי הרשת"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "מקור"

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "ביטוי רגולרי"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "החלף הכל"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&החלף עם"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "דווח"

#: lazarusidestrconsts.dlgrightbottomclr
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "קוים מנחים ימין, למטה"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "לחיצה על לחצן ימני בוחרת"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "שוליים ימניים"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "ספרייה נוכחית"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "בחר נכד"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "יצירת סרגל גמיש"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "בחירת סרגל גמיש"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "תצוגה (לא עבור win32, למשל 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "סביבה"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "מקומי"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "משתני מערכת"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "השתמש בצג"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "העמסה של משתמש"

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "ערך"

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "משתנה"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "הרץ פרמטרים"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "שמור הגדרות שולחן עבודה לקובץ"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "שורה שמורה"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "שמור מידע עורך עבור קבצים סגורים"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "שמור מידע עורך עבור קבצי הפרוייקט בלבד"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "טווח"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "גלול אחד פחות"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling:"
msgstr "גלילה:"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "הראה טיפים לגלילה"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "גלול עד לסוף הקובץ"

#: lazarusidestrconsts.dlgscrollpastendline
msgid "Caret past end of line"
msgstr "סמן אחרי סוף השורה"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "התקייה המבוקשת  \"s%\" לא נמצאה."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "החיפוש בוטל על ידי המשתמש."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "מחפש ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "נתיבים"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "ה&טקסט שנבחר"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "קבע את כל האלמנטים לברירת המחדל"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "קבע אלמנט לברירת המחדל"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "קבע את משתנה התכונות"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "הראה את כותרת הרכיב"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "הראה את הפרוצדורה המהודרת"

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "הראה אפשרויות מהדר"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "הראה מספרי שורה"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "הראה מותנים"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "הראה מידע ניפוי שגיאות"

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "הראה מאקרו מוגדרים"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "הראה טיפים של העורך"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "הראה הכל"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "הראה מידע קובץ ריצה (win32 בלבד)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "הראה מידע כללי"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "הראה טיפים לקווי עזר"

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "הראה טיפים"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "הראה מספרי שורה"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "הראה הערות"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "אל תראה כלום (רק שגיאות)"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "הראה את כל התהליכים כשיש שגיאה"

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "הראה טיפים לגלילה"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "הראה סיכום"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "הראה את קבצי \"נסה\""

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "הראה קבצים שהשתמשו בהם"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "הראה אזהרות"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "הראה לחצן בודד בפס המשימות"

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr "דלג על ההצהרות הבאות"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "לשוניות חכמות"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "סמל אחרי (pp.~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "מונה (pp.~)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "סמל לפני (pp.~)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "הצמד לקווים המנחים"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "רווח"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "טיפים למקשים המהירים העיקריים (פתח, שמור, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "עורך קוד מקור"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "מקור"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "מילת מפתח סטטית באובייקט"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "עצור אחרי מספר שגיאות:"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "תכונות משנה"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "אפשרויות תחביר"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "טאב מזיח בלוקים"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "הראה מספרי לשונית בפנקס"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "הפוך טאבים לרווחים"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "רוחב הטאב"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "משפחת המעבדים שאליה מתאימה התוכנית"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "מערכת ההפעלה שאליה מתאימה התוכנית"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "מערכת המחשב שאליה מתאימה התוכנית"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "המעבד שאליו מתאימה התוכנית"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "תיקייה לבניית פרוייקטים לנסיון"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "טקסט לחיפוש"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "התיקייה \""

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "שניה"

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "חישוב הביטוי עבור טיפ לתפריט"

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "כלים סימבוליים עבור טיפ לתפריט"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "פסגה:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "תבנית לשמות קבצים"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr "אופן צמצום רווחים"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "סמן או עריכה"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "שורה שנערכה"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "עזוב את השורה"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "מיקום בלבד"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "צמצם רווחים עוקבים"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "אופטימיזציה מפוקפקת"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "בטל שינויים אחרי שמירה"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo:"
msgstr "בטל/בצע מחדש:"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "בטל גבול"

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "פתח"

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "תלויות היחידה"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "לרענן"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "התיקייה שאליה כותבת היחידה  (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "שורה לא שמורה"

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "למעלה"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "קיפול קוד"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional Compiler Config File"
msgstr "השתמש בקובץ נוסף של הגדרות המהדר "

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr "שרטוט מפריד"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "השתמש בקובץ ההגדרות הסטנדרטי של המהדר (fpc.cfg)"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "השתמש ביישום משגר"

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "השתמש בקובץ הודעות"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "נכשל בטעינת קובץ סכמת משתמש s%"

#: lazarusidestrconsts.dlguseschemedefaults
#| msgid "Use global scheme settings"
msgid "Use (and edit) global scheme settings"
msgstr "השתמש (וערוך) בהגדרות סכמה גלובליות"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "השתמש בסכמת הגדרות מקומית"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "השתמש בהדגשת תחביר"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "השתמש בהסטוריית לשוניות בזמן סגירת לשוניות"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "ערך"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "הרחב מידע בזמן הידור:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "קו עזר גלוי"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "שוליים ימניים גלויים"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&מילים שלמות בלבד"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "רוחב:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "יישום גרפי ל Win32"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "חלון"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "מיקום חלונות"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "מילים"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "תצוגה מקדימה"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "כתוב לוגו של FPC"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "כמה רכיבים שנבחרו יחד מוכרחים להיות של טופס יחיד"

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "יישר"

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "מחק את הבחירה"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "ראי אופקי"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "ראי אנכי"

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "סדר"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "אחד אחורה"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "אחד קדימה"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "לך לאחור"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "לך לחזית"

#: lazarusidestrconsts.fdmsaveformasxml
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "שמור טופס כ XML"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "קנה מידה"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "בחר הכל"

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "גודל"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "אפשרות: הצמד לרשת"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "אפשרות: הצמד לקווים המנחים"

#: lazarusidestrconsts.fdmtaborder
msgid "Tab Order..."
msgstr "סדר הלשוניות..."

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "סדר - יורד"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "בשני הצדדים"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "לא = 0, שרטט קווי חלוקה רק עבור הרמה העליונה = 1, שרטט קווים לשתי הרמות הראשונות - 2, ..."

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "הוסף קובץ"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "הוסף קבצים"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "הוסף קבצים לחבילה"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "הוסף את קבצי LFM, LRM אם הם קיימים"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "הוסף לחבילה"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "הוסף יחידה"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "טיפוס הירוש הוא רב משמעי"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "שם המחלקה רב משמעי"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "שם יחידה רב משמעי"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "סוג קדום"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "תלויות שבורות"

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<בחר קובץ קיים>"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "שם מחלקה כבר קיים"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "צור קובץ חדש"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "תלות"

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "קובץ קיים: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "הקובץ כבר קיים"

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "קובץ s%s%s% כבר קיים בפרוייקט.  "

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "הקובץ כבר בחבילה"

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "קובץ בשימוש"

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "שם הקובץ:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "שם קובץ"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "הקובץ אינו יחידה"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "סוג קדום לא מוכר"

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "מעגל שגוי"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "שם מחלקה שגוי"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "קובץ שגוי"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "שם קובץ שגוי"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "שם יחידה שגוי"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s אינו שם תקין ליחידה."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "שם המחלקה החדשה:"

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "רכיב חדש"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "קובץ חדש"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "לא נמצאה חבילה עבור התלות s%.s%s%s%. בחר חבילה קיימת."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "שם הדף ארוך מידי"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "עמוד לוח:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "דו-שיח שמירת קובץ"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "כווץ או הארך שם קובץ"

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "הצג הכל"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "החלף נתיבים"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "לסוג הקדום s%s%s% יש אותו שם כמו ליחידה s%s%s%."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "הסוג הקדום s%s%s% אינו מזהה חוקי של פסקל"

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "הסוג הקדום s%s%s% ושם המחלקה s%s%s% זהים"

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "שם המחלקה s%s%s% כבר קיים בחבילה s%s% בקובץ: s%s%s%"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "שם המחלקה s%s%s% זהה ליחידה s%s%s%."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "שם המחלקה s%s%s% אינו מזהה חוקי של פסקל."

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "הקובץ s%s%s% כבר נמצא בחבילה."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "הקובץ s%s%s% הוא חלק מהפרוייקט הנוכחי. זה רעיון גרוע לשתף קבצים בין פרוייקטים וחבילות."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "שם הקובץ s%s%s% הוא רב משמעי, בגלל שלחבילה אין עדיין תיקיית ברירת מחדל. ציין שם קובץ עם הנתיב המלא."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "הגרסה המרבית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "הגרסה המקסימאלית נמוכה מהגרסה המינימאלית."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "הגרסה המינימלית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "לחבילה יש כבר תלות בחבילה s%s%s%."

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "שם החבילה s%s%s% שגוי. בחר חבילה קיימת."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "שם העמוד s%s%s% ארוך מדי (עד 100 תוים)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "שם היחידה s%s%s%  כבר קיים בחבילה: s%s%"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "שם הקובץ s%s%s% כבר קיים בחבילה."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "שם היחידה s%s%s%  ושם הקובץ s%s%s% שונים."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "שם היחידה s%s%s%  לא מתאים לשם הקובץ."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "שם היחידה s%s%s%  הוא שם של רכיב רשום. השמוש בו עלול לגרום להודעות שגיאה מוזרות."

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "שם קובץ היחידה:"

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "שם קובץ היחידה:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "שם היחידה:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "שם היחידה כבר קיים"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "שם היחידה שגוי"

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "סרוק את היחידה כדי למצוא את שמה ואת פרוצדורת הרישום שלה"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "לזנוח שינויים ?"

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "ארעה שגיאה בזמן יצירת חבילת היישום:"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "בטל הכל"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "בטל את כל הטעינות"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "בטל את טעינת הפרויקט"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "בטל את כל הטעינה"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "תיעוד:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "אודות  IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "אודות לזרוס"

#: lazarusidestrconsts.lisaboutlazarusmsg
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "רשיון: GPL/GPL%s לזארוס הוא IDE ליצירת יישומים (גרפיים או למסוף) בשפת free pascal. free pascal היא מהדר פסקל ופסקל מונחה עצמים ברשיון GPL/LGPL  שרץ על חלונות, ליבוקס,  מאק - גרסה 10, FreeBSD ועוד. לזארוס הוא החלק החסר בפאזל שמאפשר לך לפתח תוכנות לכל מערכות ההפעלה האלו בסביבה דמויית דלפי. ה IDE הוא כלי RAD הכולל מעצב טפסים. ככל שלזארוס גדלה אנו זקוקים ליותר מפתחים.ראה במקורות של לזארוס ו Free Pascal את פרטי הרשיון."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "לא יכול למצוא את רשימת התורמים."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "רשמי:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "ה s% אינו יכול להכיל TControls. אתה יכול לשים עליו רק רכיבים בלתי נראים."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "הכרה"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "פעולה:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "פעולות:"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "הפעל תחביר של ביטויים רגולרים עבור טקסט והחלפה (דומה לפרל)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "פעיל"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "מסנן פעיל"

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "הוסף ספרייה"

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "הוסף קבצים של ספרייה"

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "אפשרויות מהדר נוספות מורשות מחבילות"

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "הוספת אופן בנייה, מעתיק הגדרות מ \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "הוסף מאקרו חדש"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "הוסף קבוצה חדשה"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "הוסף דרישות חבילה?"

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "הוסף חבילה s% לפרוייקט?"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "הוסף חבילה לפרוייקט"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "הוסף סוגריים של פרמטר"

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "להוסיף לנתיב החיפוש של קבצי \"כלול\""

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "להוסיף את %s לפרויקט ?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "להוסיף לנתיב החיפוש של היחידות?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "הוסף ממשקי יחידה"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "הוסף יחידה (לא מומלץ)"

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "הוסף ערך:"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "הוסף ערך למאקרו %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "הוסף קובץ לחבילה"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "חבילת היעד"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "סוג הקובץ"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "פרוצדורת רישום קיימת"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "חבילה שגויה"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "זהוי חבילה שגוי: s%s%s%"

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "יחידה ווירטואלית (הקוד אינו בחבילה)"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "החבילה היא לקריאה בלבד"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "החבילה %s%s%s לא נמצאה."

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "הצג הכל"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "הקובץ s%s%s% כבר נמצא בחבילה s%."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "החבילה s% היא לקריאה בלבד."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "שם יחידה:"

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "הקובץ %s%s%s כבר קיים.%sהאם להחליפו?"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "יישור"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "כל הבלוקים נראים תקינים."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "כל הקבצים"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "כל האפשרויות שעברו בהורשה"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "אפשר קריאות של פונקציות"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "אפשר חיפוש בשורות מרובות"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "כל השינויים שלך של %s%s%s%sיאבדו והקובץ יפתח מחדש."

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "מקש חלופי"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "מקש חלופי (או רצף של 2 מקשים)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "תמיד"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "התעלם תמיד"

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "קובץ רב משמעי נמצא"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "נמצא קובץ רב משמעי: s%s%s% יכול להיות שהוא נלקח בטעות במקום s%s%s%s%s%. האם למחוק אותו?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "נמצא קובץ רב משמעי"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "נמצאה יחידה רב משמעית"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "נמצאה יחידה רב משמעית"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "עגן עורך - לא נבחרו פקדים"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "אפשר = כלול s% בעוגנים"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "עיגון של הפקדים שנבחרו"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "עגן לצד התחתון של העצם הדומה, שמור על רווח מפריד"

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "עגן לצד השמאלי של העצם הדומה, שמור על רווח מפריד"

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "עגן לצד הימני של העצם הדומה, שמור על רווח מפריד"

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "עגן לצד העליון של העצם הדומה, שמור על רווח מפריד"

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "ארעה שגיאה באיתחול האחרון בזמן טעינת s!%s%s%. האם לטעון את הפרוייקט שוב?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "הוסף תאור קצר אחרי תאור מפורט"

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "יישום s% גרפי של תוכנית lcl/freepascal . התכנית מתוחזקת אוטומטית ע\"י לזארוס."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "שם המחלקה של היישום"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "השתמש בדגלי בניה (B-) גם לתלויות"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "יחידה של פרוייקט אינה יכולה לשמש לפרוייקט או חבילה אחרים"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "רווח מסביב לפקד. שאר ארבעת הרווחים מתוספים אליו."

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "קובץ פשוט של תכנית פסקל. הוא יכול לשמש לבדיקה מהירה ולא נקייה. עדיף ליצור פרוייקט חדש."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "שאל לפני החלפה של כל מופע של הטקסט שנמצא"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "בקש את שם הרכיב אחרי שתכניס אותו לטופס המעצב"

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "בקש את שם הקובץ בפתיחת קובץ חדש"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "בקש שם ב יצירה"

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "השלמה אוטומטית: כבה"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "השלמה אוטומטית: הדלק"

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "המשך אוטומטית"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "המשך אוטומטית אחרי:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr "אוטומטי"

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "המר אוטומטית קבצי lfm. לקבצי lrs. \"כלול\""

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "הפעל אוטומטית אחרי נקודה"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "שבירת שורה"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "רווח"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "סוף מילה"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "אל תוסיף תו"

#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "תכונות אוטומטיות"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "הצגה אוטומטית"

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "חבילות זמינות"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "צור גיבוי לקבצים ששונו"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "קובץ הגיבוי נכשל"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "יוצר תיקיית גיבוי בתוך תיקיית הפרוייקט"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "שינוי שם חבילה או גרסה שובר את התלויות. האם לשנות את התלויות בנוסף?%sבחר \"כן\" לשנות את כל התלויות הרשומות.%sבחר \"התעלם\" לשבור את התלויות ולהמשיך."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "מתחיל"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "מאחורי הקשורים"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "תמיד בנה לפני ריצה"

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "בנה"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "פקודת בנייה"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "בצע בניית קובץ במקום בניית פרוייקט"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "בצע הרצת קובץ במקום הרצת פרוייקט"

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "הרץ"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "הרץ פקודה"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "כאשר קובץ זה פעיל בעורך הקוד ..."

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "ספריית עבודה (השאר ריק לנתיב הקובץ)"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "ספריית עבודה (השאר ריק לנתיב הקובץ)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "הדגש (bold) ערכים שאינם ברירת מחדל"

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "מרווח גבול"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "תחתית"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "רווח תחתון. רווח זה מתווסף לרווח הבסיסי של הפקד."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "עיגון לתחתית"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "תחתיות"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "זהו פקד \"אח\" אליו מוצמד הצד התחתון. השאר ריק בשביל הורה."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "רווח שווה בתחתית"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "שבור"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "תכונות נקודת עצירה"

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "דפדף לחיפוש מהדר(s%)"

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "שבור"

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "המשך"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "חפש"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "החלף"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "בנה את כל הקבצים של פרוייקט/חבילה/IDE"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "בנה את ה IDE עם חבילות"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "בניית לזארוס נכשלה"

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr "מאקרו לבניה"

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr "מאקרו בנייה:"

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "מוד בנייה"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "הבדלים בין אופני בניה"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr ""

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "אופן:"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "אופני בנייה"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "בנה פרויקט חדש"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "מספר הבניה"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "קריאת s% ליצירת makefile מ s% נכשלה."

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "בטל טעינת הרכיב"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "בטל את טעינת היחידה"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "בטל את שינוי השם"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "לא יכול להדר את הפרוייקט"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "לא יכול להעתיק רכיב של הרמה העליונה."

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "לא יכול לצור את הקובץ s%s%s%"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "לא יכול למצוא את מאתחל לזארוס: s%s%"

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "יכול רק לשנות את המחלקה של TCcomponent.."

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "שנה את המחלקה של %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "אין מחלקה"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "המהדר רב משמעי"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "אנא בדוק את ספריית הבדיקות תחת %sEnvironment -> Environment Options -> Files -> Directory for building test projects"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "המהדר s% אינו קובץ ריצה. s% פרטים: s%"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "מכיל"

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "העתק פלט ללוח הגזירים"

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "הזמנים של קבצי ppu. של FPC שונים ביותר משעה. יכול להיות שזה אומר שהם שייכים לשתי התקנות שונות. קובץ 1:s%s% קובץ 2 s%"

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "קובץ הודעות באנגלית עבור fpc חסר: הודעת שגיאה של רכיבים/CodeTools/fpc"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "שגיאה"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "שגיאה:"

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "נתיב יחידה של FPC מכיל מקור:"

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "סמלי שורה חדשים"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "טיפ:"

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "מהדר שגוי"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "נתיב חיפוש שגוי"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "ספריית בדיקות שגויה"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "יחידה חסרה"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "לא נמצאה היחידה המהודרת של FPC: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "נמצאו מספר קבצי הגדרה למהדר"

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "לא נמצא הקובץ fpc.cfg"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "לא ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "קובץ ה ppu קיים פעמיים: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "היחידה s%.ppu המהודרת של FPC לא נמצאה. בדרך כלל זה אומר שיש באג בקובץ fpc.cfg, או שההתקנה של FPC שבורה."

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "יש קובץ ppu. ישן יותר מהמהדר עצמו:s%s%"

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "הנתיב היחסי של היחידה נמצא ב fpc.cfg: %s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "יש כמה מהדרי fpc בנתיב שלך.s%s%s% אולי שכחת למחוק מהדר ישן?"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "דלג"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "תווים מיוחדים"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "כל הבדיקות צלחו."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "לא ניתן ליצור קובץ בדיקה"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "לא ניתן ליצור את קובץ הבדיקה לפסקל \"%s\"."

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "לא ניתן לקבל את התאריך של הקובץ %s"

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "תוווים מיוחדים"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "אזהרה"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "אזהרה:"

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "מפריד הנתיב שגוי"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "קטגוריות"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "סיבוכיות"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "קבועים"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "בלוקים ריקים"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "קטעי מחלקות ריקים"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "הגדרת יוצרים ריקה"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "פרוצדורות ריקות"

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(סנן)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "עקוב אחר סמן העכבר"

#: lazarusidestrconsts.liscein
msgid "%s in %s"
msgstr "%s ב %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "הוא בשליטה של ה root"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr "מספר הפרמטרים מטופל כ many"

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "פרוצדורות ארוכות"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "מספר שורות הפרוצדורה מטופל כ long"

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "פרוצדורות מקוננות רבות"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "פרמטרים רבים"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "הצג קטגוריות"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "הראה צמתי קוד המקור"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr "מספר הפרוצדורות המקוננות מטופל כ many"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "מרכז את הפקד בצורה אופקית יחסית לאח שנבחר"

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "מרכז את הפקד בצורה אנכית יחסית לאח שנבחר"

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr "מרכז טופס"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "מרכז בחלון"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "מרכז"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "תצורת החשיפה הרצויה"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "קטגוריה"

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr "מקור"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "לעולם לא, רק ידני"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "נמצא בשימוש רק במצב של קטגוריות"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "בהמתנה"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "ריענון אוטומטי"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "אחר"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "עדכן"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "כאשר מחליפים קובץ בעורך הקוד"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "פרוצדורות"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "תכונות"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "תכונות שפורסמו ללא ברירת מחדל"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "הראה תצפית על"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "סגנון"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "לעשות"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "סוגים"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "קבועים ללא שם"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "חברים לא מסודרים"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "תצוגה לא מסודרת"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "משתמש ב"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "משתנים"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "הזחה שגויה"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "שנה את אופן הבנייה"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "שנה את המחלקה"

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "שנה קידוד"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "שנה קובץ"

#: lazarusidestrconsts.lischangeparent
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "שנה הורה..."

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "תו"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "מפת תווים"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "בדוק שינויים על הדיסק בזמן הטעינה"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "בדוק אם הסימן הבא בקוד הוא הוא :סוף\" ואם לא החזר linend +end; "

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "בדוק אפשרויות"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "בחר בשם אחר"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "בחר קישור ל FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "בחר מקשר ..."

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "בחר שם לרכיב החדש"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "בחר קובץ פסקל עבור דוגמאות זיהוי"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "בחר קובץ להודעות מהדר"

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "בחר בשם הקובץ של המהדר (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "בחר בשם הקובץ של מנפה השגיאות"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "בחר חבילת דלפי (dpk.*)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "בחר פרוייקט דלפי חדש (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "בחר יחידת דלפי (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "בחר ספרייה"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "בחר את ספריית קוד המקור של FPC"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "בחר את ספריית לזרוס"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "בחר את נתיב make"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "בחר שם"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "בחר את אחד מהפריטים ליצירת קובץ חדש"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "בחר את אחד מהפריטים ליצירת חבילה חדשה"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "בחר אחד מהפריטים ליצירת פרויקט חדש"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "בחר את אחד הפריטים בשביל לרשת מפריט קיים"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "בחר בקוד המקור של התוכנה (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "בחר מבנה נתונים לעטיפת הבחירה"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "בחר את התיקיה עבור בדיקות"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "השלמת מחלקה"

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "המחלקה מתנגשת עם קובץ ifm. היחידה s%s% משתמשת ביחידה s%s% אשר מכילה את המחלקה s%, אבל קובץ ה ifm. מכיל כבר מחלקה אחרת. יכולה להיות רק מחלקת עיצוב אחת ליחידה.הזז את s% ליחידה אחרת."

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "המחלקה והתכונות קיימות. הערכים לא בדוקים."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "המחלקה s%s%s% אינה מחלקה רשומה. לא מצליח להדביק."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "המחלקה לא נמצאה"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "המחלקה s%s%s% של מתודה s%s%s% לא נמצאה."

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "נקה ספרייה"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "נקה את תתי הספריות"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "שמור את כל קבצי הטקסט"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "שמור קבצים המתאימים למסנן"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "מחק קבצים המתאימים למסנן"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "תחביר פשוט (כלומר * במקום .*)"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "נקה את קוד המקור של לזרוס"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "האם לנקות את נתיב היחידה?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "האם לנקות את הספרייה?"

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr "נקה מיפוי מקשים"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "לחץ כאן בשביל לצפות בקובץ"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr "הקלק כדי לראות את השימושים האפשריים"

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "ס&גור"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "סגור קבצים"

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "הסתר חלון"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "סוגר את חלון עורך הקוד. האם אתה מעוניין לסגור את כל הקבצים או להחביא את החלון ?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "סגור את חלון עורך הקוד"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "אפשרויות ספציפיות עבור ממשקי LCL:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "פרמטר"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "רכיבים"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "ירושה"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "רשימה"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "לוח"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "קובץ הגדרות המהדר שנוסף אינו חד משמעי"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "קרא ל:"

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "בנה"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "הדר"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "ריצה"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "לחץ על OK אם אתה בטוח שברצונך לעשות זאת."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "פקודה:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "קוד"

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "דפדפן הקוד"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "ברירת מחדל (%s)"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "אפשרויות יצירת קוד"

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "הוסף קישור"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "הוסף נתיב"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "דפדף"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "אשר החלפה"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "צור פריט עזרה"

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "מחק קישור"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "הסר נתיב"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "תאור"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "שגיאות"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "דוגמה"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "הכנס תגית של טקסט מודגש"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "הכנס תגית של קוד"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "הכנס תגית של טקסט נטוי"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "הכנס תגית של הערה"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "הכנס תגית של טקסט עם קו תחתון"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "הכנס תגית של משתנה"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "מורש"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "הוסף קישור ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "הכנס תגית של סעיף"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "עורך FPDoc"

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(ללא)"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(לא נמצא תאור מורש)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<ללא>"

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "נתיב של קבצי FPDoc"

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "החלף"

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "שמור"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "ראה גם"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "תאור קצר של"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "קצר"

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "הראה מתודות ריקות"

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr "הראה מתודות שלא השתמשת בהן"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "התעלם מקבועים בפונקציות הבאות"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "חפש קבועים מסוג תו ללא שם"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "צופה הקוד"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "התעלם מהקבועים חסרי השם הבאים"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "הוסף"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "הוסף תבנית קוד"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "סמל s%s%s% כבר קיים!"

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "השלמה אוטומטית ב"

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "שנה"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "הערה"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "ערוך תבנית קוד"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "שגיאה"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "סמל:"

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "פעולה: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "אי אםשר לערוך צמתים שנוצרו אוטומטית, ולא יכול להיות שיש להן צמתים בנות, שלא נוצרו אוטומטית."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "נוצר אוטומטית"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "אי אםשר לערוך צמתים שנוצרו אוטומטית,"

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "בלוק"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "הגדרת עורכים  ע\"י CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "הגדרת תצוגה מקדימה ע\"י CodeTools"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "נתיב המהדר"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "המר צומת"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "צור מגדירים לתקיית s%"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "צור מגדירים למהדר fpc"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "צור מגדירים למקורות SVN של מהדר fpc"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "צור מגדירים לתיקיית לזארוס"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "צור מגדירים לפרוייקט s%"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "צור מאקרו ונתיבים של fpc עבור תקיית פרוייקט fpc"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "הגדר"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "הגדר משאב"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "מחק צומת"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד. למשל: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד, אשר בשמוש בפרוייקט זה. למשל: C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "תאור:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "ספרייה %s"

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "עריכה"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "אחרת"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "אחרת אם"

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "שגיאה בקריאת s%s%s%s%s%"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "שגיאה בקריאת קובץ מידע הפרוייקט s%s%s%s%s%"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "שגיאה בכתיבת s%s%s%s%s%"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "שגיאה בכתיבת קובץ מידע הפרוייקט s%s%s%s%s%"

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "יציאה"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "צא בלי לשמור"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "תיקיית הקוד של FPC SVN"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "אם "

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "אם מוגדר"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "אם לא מוגדר"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "תיקייה"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "הכנס תבנית של המהדר דלפי 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "הכנס תבנית של תיקיית דלפי 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "הכנס תבנית של פרוייקט דלפי 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "הכנס תבנית של המהדר fpc"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "הכנס תבנית של פרוייקט fpc"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "הכנס תבנית קוד של FPC SVN"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "הכנס תבנית של המהדר 3 Kylix"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "הכנס תבנית של תיקיית 3 Kylix"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "הכנס תבנית של פרוייקט 3 Kylix"

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "הכנס תבנית של תיקיית לזארוס"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "הכנס צומת כצומת בת"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "הכנס צומת מתחת"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "הכנס תבנית"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "הורה פגום"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "צומת הורה פגומה"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "צומת קודמת פגומה"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד. למשל: home/user/kylix%s/"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "התיקייה הראשית s% שבה הותקנו כל קבצי הקוד של בורלנד, אשר בשמוש בפרוייקט זה. למשל: home/user/kylix%s/"

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "תיקיית לזארוס"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "הזז צומת למטה"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "הזז צומת רמה אחת למטה"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "הזז צומת רמה אחת למעלה"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "הזז צומת למעלה"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "שם:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "צומת חדשה"

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "צומת עם ילדים תקפים רק לפרויקט הנוכחי"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "הצומת במצב של קריאה בלבד"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "ללא בחירה"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr " צומת אם לא יכולה להכיל צמתי בנות"

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "הצומת הקודמת אינה יכולה להכיל צמתים בתור ילדים"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "תיקיית הפרוייקט"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "תיקיית הפרוייקט s%"

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "יחודי לפרוייקט s%,"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "שגיאת קריאה"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "שמור וצא"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "צומת נבחרת:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "תיקיית קוד המקור של FPC SVN. לא נדרשת. זה ישפר את ניפוי השגיאות ואת חיפוש ההצהרות."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "תיקיית הפרוייקטים של fpc."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "תיקיית קוד המקור של FPC SVN."

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "התיקייה הראשית של לאזרוס."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "הנתיב למהדר fpc. למשל/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s/."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "הנתיב למהדר fpc עבור פרוייקט זה. דרוש רק אם הגדרת את קבצי קוד המקור של FPC SVN שלהלן. משמש ליצירה אוטומטית של מאקרו."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "תיקיית הפרוייקט s%, שמכילה את קבצי dpr .dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "בטל הגדרה"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "בטל את כל ההגדרות"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "בטל הגדרת משאב"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "ערך כנתיבי קובץ"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "ערך כטקסט"

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "משתנה:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "שגיאת כתיבה"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "ב"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "סוגרים"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "נקודותיים"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "פסיק"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "מזהה"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "מלת מפתח"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "שורה חדשה"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "ללא"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "מספר"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "אשר"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "נקודה"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "נקודה פסיק"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "רווח"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "קבוע מסוג מחרוזת"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "סמל"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "בצע אחרי"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "בצע לפני"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "צמצם את כל המחלקות"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "צמצם את כל החבילות"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "צמצם את כל היחידות"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "פקודה אחרי"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "פקודה שאחרי לא חוקית"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "פקודה אחרי פרסום מודול"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "פרמטרים של שורת הפקודה של התוכנה"

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "הדר IDE (ללא קישור)"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "מהדר"

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "שגיאת מהדר"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "שגיאה: מהדר s% לא חוקי"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "שם הקובץ של המהדר"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "טיפ: אתה יכול להגדיר את נתיב המהדר ב Environment->Environment options->Files->Compiler Path"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "הערה: קובץ ההגדרה של CodeTools לא נמצא - משתמש בברירת המחדל"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "הערה: טוען את קובץ אפשרויות CodeTools הישן"

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "אפשרויות מהדר עבור פרויקט: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (מהדר ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "הראה טיפים לשורה ארוכה"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "הרחב לקצה השמאלי"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "הרחב קצת שמאלה"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "אף פעם"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "הרחב ימינה בלבד"

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "רכיב"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr "שם הרכיב  \"%s\" הוא מילת מפתח של פסקל"

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "שם הרכיב s%s%s% הוא מלת מפתח"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "שם הרכיב s%s%s% אינו מזהה חוקי"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "מצא רכיב"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "פתח חבילה"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "פתח יחידה"

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "בדוק"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "מצב"

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr "התניות"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "ספריית הגדרות לזרוס"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "מגדיר את הבנייה של %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "הגדר ובנה את לזארוס"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "לזארוס ייבנה עם הפרופיל הבא:%s להמשיך?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "אשר שינויים"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "וודא מחיקה"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "האם ברצונך לבנות מחדש את לזרוס?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "אשר חבילה חדשה עבור הIDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "פעולה"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "קבוצת חבילות חדשה"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "קבוצת חבילות ישנה"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "יישום מסוף"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "קוד הפונקציה הבונה"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "מכיל"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "תלוי בהקשר"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "המשך"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "המשך ואל תשאל שוב"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "המשך ללא טעינת הטופס"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "תורמים"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "הפקד חייב הורה"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "התווסף אופסט לקואורדינטה העליונה של פקדים בתוך המיכלים הנראים"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "אופסט לקואורדינטות"

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr "נפסק"

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr "כל תתי התיקיות ייסרקו למציאת קבצי יחידות"

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr "בשלב זה לא אמורות להיות יחידות חסרות"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "נכשל BeginCodeTools"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "קטגוריות:"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "ההמרה נפסקה"

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "ההמרה מוכנה"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "המר חבילת דלפי"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "המר פרוייקט דלפי"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "המר יחידת דלפי"

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr "ממיר קובץ יחידה %s"

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr "*** ממיר קבצי יחידה... ***"

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr "קובץ קוד ראשי של יחידת דלפי (.dpk) לא נמצא עבור חבילה %s%s"

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "שגיאה=\"%s\""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr "שגיאה%s(%s,%s): לא מוצא יחידה %s"

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "לא הצליח להמיר יחידה "

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr "לא הצליח להמיר יחידה %s%s%s"

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr "*** מצא את כל קבצי היחידה... ***"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "פונקציית דלפי"

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr "שמור את שנייהם"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "חסר קובץ \"כלול\" %s(%s,%s)"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "שם של דלפי"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "שם החבילה קיים"

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr "מוכן."

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr "הסר יחידה שנמצאת בסעיף \"משתמש ב\""

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr "הסר ראשון"

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr "הסר שני"

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr "מתקן מקובץ %s"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr "*** מתקן מקבצים... ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "הוחלפה יחידה \"%s\" ביחידה \"%s\" שנמצאת בסעיף \"משתמש ב\""

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr "דלג על קובץ זה"

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr "דלג על שלב זה"

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr "יחידות אחדות של חבילת דלפי חסרות: %s%s"

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr "יש שתי יחידות עם אותו שם: %s%s%s%s%s"

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "יש כבר יחידה עם השם \"%s\"%s, סגור חבילה זאת קודם."

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr "שם יחידה קיים פעמיים"

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr "יחידות לא נמצאו"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "יחידות להחלפה ב %s"

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "שגיאת המרה"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "המר"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "המר קידוד"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "המר את קידוד הפרויקט/חבילה"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "המר פרויקט או חבילה"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "הממיר מוסיף הידור מותנה כדי לתמוך ביעדים שונים"

#: lazarusidestrconsts.lisconverttargetlaz
#, fuzzy
#| msgid "Lazarus / LCL"
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr "לזארוס / LCL"

#: lazarusidestrconsts.lisconverttargetlazanddelphi
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr "לזארוס ודלפי"

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr "לזארוס ודלפי בעלי אותו קובץ DFM"

#: lazarusidestrconsts.lisconverttargetlazwinonly
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr "גם עבור חלונות בלבד"

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "החלפת פונקציות"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "פונקציות דלפי מסוימות ניתנות להחלפה בפונקציות LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "פונקציות/פרוצדורות להחליף"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "אופסט שמאלי"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "שם חדש"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "מיכל הורה"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "אופסט עליון"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "החלפת סוג משתנה"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "סוגים לא מוכרים בקובץ הטופס (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "סוג משתנה להחלפה"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "החלפת יחידות"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "שמות היחידות בסעיף \"משתמש ב\" של יחידת הקוד"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "יחידות להחלפה"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "תכונות לא ידועות"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "העתק הכל"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr "העתק את כל הפריטים ללוח הזמני"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "העתק את כל הפלט ללוח הזמני"

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr "העתק את כל ההודעות הגלויות והנסתרות ללוח הזמני"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr "העתק את כל ההודעות ללוח הזמני"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "העתק תיאור ללוח הזמני"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "שגיאת העתקה"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "שגיאת העתקה"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "העתק את s%s%s% ללוח הזמני"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "העתקת טופס שלם לא מומשה"

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr "העתק פריט ללוח הזמני"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr "העתק את הפריטים שנבחרו ללוח הזמני"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "העתק את ההודעות הנבחרות ללוח הגזירים"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "סרוק הודעות של FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "סרוק הודעות של Make"

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "הצג את כל ההודעות"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "דלג על קריאה למהדר"

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "אפשרויות תלויות במערכת ההפעלה המיועדת"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "לא יכול להוסיף את  %s{$I %s%s} לקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "לא יכול להוסיף את  %s{$R %s%s} לקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "לא יכול להוסיף את %s%s%s לקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "לא יכול להסיר את %s%s%s מקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "לא יכול להסיר את  %s{$I %s%s} מקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "לא יכול להסיר את  %s{$R %s%s} מקובץ הקוד הראשי!"

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (משתנים)"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "אזהרה: קובץ ההגדרות הנוספים למהדר הוא בעל אותו השם, כמו של אחד מקבצי ההגדרות הסטנדרטיים ש FreePascal מחפש. שימוש בקובץ כזה יגרום לתוצאה בה הקובץ הנוסף יפורש, והמהדר ידלג על הקובץ הגדרות הראשי."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "פתח חבילה %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "פתח יחידה %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "צור קודם פרויקט!"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "ליצור ספרייה?"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "צור פונקציה"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "צור צומת עזרה"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "צור זאת"

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "צור פרוייקט חדש"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "צור פרוייקט"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "צור/עדכן קובץ po. כאשר אתה שומר את קובץ lfm"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "יוצר אינדקס לקובץ קוד של FPC "

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "בחר ספרייה"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "ערכי תיקיית CodeTools"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "הגדר תבניות"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<לא נבחרו משתנים>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "פתח תצוגה מקדימה"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "כלים"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "משתנה: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "שם משתנה"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "תבניות"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "אנא בחר במקרו"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "בחר תבנית קוד"

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr "נוכחי"

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "העמודה בה נמצא הסמן בעורך הנוכחי"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "השורה בה נמצא הסמן בעורך הנוכחי"

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr "מאקרו בניה מותאם אישית"

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "אפשרויות מותאמות אישית"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "אפשרויות מותאמות אישית"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "תכנית של המשתמש"

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
msgid "Custom Program%sA Free Pascal program."
msgstr "תכנית של המשתמש s%. תוכנית ב Free Pascal "

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "מודול תאריך"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "תאריך"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "מחק הכל"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "מחק הכל"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "נטרל הכל"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "נטרל הכל"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "אפשר הכל"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "אפשר הכל"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr "העתק ללוח הזמני"

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "מחק"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "מחק"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "נטרל"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "נטרל"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "אפשר"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "אפשר"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "לא צויין מנפה שגיאות"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "הגדר את נקודת העצירה בכל זאת"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "לא צוין מנפה שגיאות. אין השפעה להגדרת נקודות עצירה עד שתגדיר מנפה שגיאות בדיאלוג מנפי השגיאות שבתפריט."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "מופעל/מופסק"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "נטרל/אפשר עידכון של כל החלון"

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "שגיאה של מנפה השגיאות"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "שגיאת מנפה שגיאות s% אופס, המנפה נכנס למצב של שגיאה. שמור את עבודתך כעת! הקש על עצור, וקווה לטוב, אנחנו שולפיים את התקע."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "מנפה שגיאות לא תקין"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "(ניפוי שגיאות)"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "הוסף חריגה"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "נתיב חיפוש נוסף"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "נקודת עצירה"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "נקה את היומן בזמן ריצה"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "מנפה שגיאות"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "הגדרות ניפוי שגיאות כלליות"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "אפשרות תלויית מנפה (תלויה בסוג מנפה השגיאות)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "שם כפול של חריגה "

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "הכנס את שם החריגה"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "דו\"ח אירועים"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "מטופל ע\"י"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "מטופל ע\"י מנפה השגיאות"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "מטופל ע\"י התכנית"

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "התעלם מחריגות אלו"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "חריגות שפה"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "הגבל את מספור השורות ל"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "מודול"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "שם"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "הודע על חריגות לזארוס"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "חריגות מערכת הפעלה"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "פלט"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "תהליך"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "המשך"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "המשך במטופל"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "המשך בלא מטופל"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "הראה הודעה בעצירה"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "אותות"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "תהליך"

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "חלון"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "לא ניתן לטעון קובץ"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "לא ניתן לטעון את הקובץ %s%s%s."

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr "עשרוני"

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "ערך ברירת מחדל"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "השהייה עבור טיפים ארוכים בתיבת ההשלמה"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "השהייה לטיפים ותיבת השלמה"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "מחק& הכל"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "מחק את כל נקודות העצירה?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "מחק את כל נקודות העצירה בקובץ s%s%s%?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "מחק הכל באותו קובץ מקור"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "מחק את כל נקודות העצירה שנבחרו?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "למחוק את כל הקבצים?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "מחק קובץ רב משמעי?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "מחק נקודת עצירה"

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "מחק נקודת עצירה ב s%s% בשורה d%?"

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr "למחוק את מאקרו הבניה %s%s%s?"

#: lazarusidestrconsts.lisdeletebuildmode
msgctxt "lazarusidestrconsts.lisdeletebuildmode"
msgid "Delete build mode"
msgstr "מחק את מצב הבניה"

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "מחק את מצב הבניה?"

#: lazarusidestrconsts.lisdeletebuildmode3
msgctxt "lazarusidestrconsts.lisdeletebuildmode3"
msgid "Delete build mode %s%s%s?"
msgstr "מחק את מצב הבניה s%s%s%?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "מחיקת קובץ נכשלה"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr "מחק מאקרו %s"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "מחק אופן  \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "האם למחוק קובץ ישן s%s%s%?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "למחוק קובץ ישן ?"

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "מחק שורה"

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "מחק את הקבצים שנבחרו"

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr "מחק הגדרות"

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr "מחק הגדרות?"

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr "מחק הגדרות s%s%s%?"

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "מחק ערך s%s%s%"

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "מחק ערך %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "מחיקת הקובץ s%s%s% נכשלה."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "דלפי"

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "חבילת דלפי"

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "פרוייקט דלפי"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "יחידת דלפי"

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "יש כבר רכיב אחר עם השם s%s%s%."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "תיקיית היעד"

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "תיקיית היעד s%s%s% אינה חוקית. בחר בנתיב השלם."

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "קוד הפונקציה ההורסת"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "בלתי תלוי ברישיות"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "התעלם אם נוספו או הוסרו שורות ריקות"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "התעלם מהשוני של סוף שורה (כלומר #10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "התעלם מכמות תווי הרווחים"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "התעלם מרווחים ( התוים של שורה חדשה לא כלולים)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "התעלם מרווחים בסוף שורה"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "התעלם מרווחים בהתחלת שורה"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "רק בחירה"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "פתח Diff בעורך"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "טקסט1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "טקסט2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "ספרות:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "הנחיות"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "הוראות ליחידה חדשה"

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "תיקייה s%s%s% לא נמצאה."

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "אי אפשר לכתוב לתיקייה"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "התיקייה שבה ה IDE שם את קבצי po."

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "נטרל הכל באותו קובץ מקור"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "נטרל נקודת עצירה"

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "מבוטל"

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr "בטל קבוצה"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "נטרל I18N עבור LFM"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr "לך לכתובת"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr "לך לכתובת"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr "לך לכתובת נוכחית"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr "לך לכתובת נוכחית"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "בטל שינויים"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "בטל את כל השינויים"

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "קבצים ששונו:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "לחץ על אחד הפריטים שלמעלה כדי לצפות ב diff"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "שגיאה בקריאת קובץ: s%"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "התעלם מהשינויים בדיסק"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "טען מחדש מהדיסק"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "מספר קבצים השתנו בדיסק:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "הבחן בין אותיות גדולות וקטנות למשל A ו a"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "עורך תיעוד"

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s לא קיים: %s"

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "על תסגור את ה IDE"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "אל תסגור את הפרוייקט"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "אל תהדר תלויות"

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr "אל תתקין"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "אל תציג מצג פתיחה"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "אל תראה דיאלוג עבור פרוייקט זה"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "אל תראה הודעה זאת שוב"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "שרטט קווי רשת"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "העתק את הרכיבים הנבחרים ללוח הזמני"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "העבר את הרכיבים שנבחרו ללוח הזמני"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "הזז רכיב אחד לאחור"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "הזז רכיב אחד לפנים"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "הזז רכיב אחד אחורה"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "הזז רכיב אחד לחזית"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "בחר את הרכיבים שנבחרו מהלוח הזמני"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "בחר רכיב הורה"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "נמצאה כפילות בערך s%s%s%."

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "כפילות בשם: רכיב בשם s%s%s% כבר קיים ברכיב המורש s%"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "מסלול חיפוש כפול"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "ערוך עזרה תלויית הקשר"

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "בחר סכמה"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "כל החבילות"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "הפרויקט הנוכחי"

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "ספריית הפרויקט הנוכחי"

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "הוספת נתיב קוד גלובלי"

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "נתיב יחסי לפרוייקט"

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "נתיב קוד המקור של הפרויקט"

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "נתיב יחידות הפרויקט"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "כל הפרויקטים"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "הגדר מצב FPC לדלפי"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "הגדר מצב FPC ל FPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "הגדר מצב FPC ל GPC"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "הגדר מצב FPC ל MacPas"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "הגדר מצב FPC ל TP"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "הפעל בדיקות קלט/פלט"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "הפעל בדיקת גלישה"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "הפעל בדיקת טווח"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr " השתמש ביחידה HeapTrc"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "השתמש ביחידה LineInfo"

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "כלי חוקי צריך לפחות כותרת ושם קובץ."

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "ערוך כלי"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "הסתר טופס ראשי"

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "הכנס"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "מפתח"

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "מאקרויים"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "פרמטרים:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "שם התוכנית:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "סרוק פלט להודעות מהדר של Free Pascal "

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "סרוק פלט להודעות make"

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "כותרת ושם קובץ נדרשים"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "ספריית העבודה:"

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "הכל"

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "מתודות ריקות"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "נמצאה מתודה ריקה:"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "רק published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "ציבורי"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "מחק מתודות"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "חפש בחלקי מחלקה אלו:"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "ריק"

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "אפשר הכל"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "אפשר הכל באותו הקובץ"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "אפשר נקודת עצירה"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "מאופשר"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr "אפשר קבוצה"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "אפשר בינאום ותמיכה בתרגום"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "אפשר מאקרו"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "צרף "

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr "צרף בחירה"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "הקידוד של הקובץ s%s%s% בדיסק sהוא %. הקידוד החדש הוא s%. "

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "הקידוד של הקובץ s%s%s% בדיסק sהוא %. הקידוד החדש הוא s%. "

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "הזן את השפה לתרגום"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "משתנה סביבה, תן שם כמו לפרמטר"

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "קפוץ מההודעה לשורת הקוד בלחיצה כפולה(אחרת: בלחיצה בודדת)"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "תיקייה לא נמצאה"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "תיקיית קוד המקור s% של FPC לא נמצאה."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "שם קובץ לא חוקי של המהדר"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "הקובץ s% של המהדר אינו קובץ ריצה."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "שם קובץ לא חוקי של מנפה השגיאות"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "הקובץ s% של מנפה השגיאות אינו קובץ ריצה."

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "תיקיית קוד המקור s% של FPC ניראת לא בסדר. היא צריכה להכיל תיקיות כמו  rtl/inc, packages/fcl-base, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "תיקיית לזארוס s% ניראת לא בסדר. היא צריכה להכיל תיקיות כמו lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "שם קובץ make לא חוקי"

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "קובץ ה make %s אינו קובץ ריצה. "

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "תיקיית לזארוס s% לא נמצאה."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "תיקיית הבדיקה s% לא נמצאה."

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "הערה: רק נתיב מוחלט  נתמך כעת"

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "רוחב הטאב"

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "במיקום %d האפשרות לא תקינה: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "אין הרשאה לאפשרות במיקום %d להיות בשימוש עם הארגומנט: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "האפשרות במיקום %d זקוקה לארגומנט: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "שגיאה:"

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "שגיאה ביצירת קובץ"

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "שגיאה ביצירת lrs"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "שגיאה במחיקת קובץ"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "שגיאה ב s%"

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "שגיאה באיתחול תכנית s%s%s%s%s% שגיאה: s%"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "שגיאה בטעינת קובץ"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "שגיאה בטעינת קובץ \"%s\":%s%s"

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "שגיאה בטעינת s% מ s%s%s%s%"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "שגיאה בהזזת רכיב"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "שגיאה בהזזת רכיב s%: %s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "שגיאה בנתינת שם לרכיב"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "שגיאה בפתיחת רכיב"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "שגיאה בפרוש רכיב lfm של הזרימה"

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "שגיאה בקריאת רשימת חבילות מהקובץ s%s%s%s%"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "שגיאה בקריאת קובץ XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "שגיאה בקריאת קובץ xml %s%s%s%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "שגיאה במתן שם לקובץ"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "שגיאות"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "שגיאה בשמירת s% ל s%s%s%s%"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "שגיאה בהגדרת שם ברכיב s% ל s%"

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "שגיאה בכתיבת רשימת חבילות לקובץ s%s%%s%"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "ערוך את סורקים מותאמים אישית (s%)"

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr "חשב את הביטוי"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "חשב"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "כל שורה שמספרה הוא n:"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "קובץ דוגמה"

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "דוגמאות"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "דוגמה: מזהים TMyEnum.Enum \"שם יחידה.מזהה\"  \"#שם חבילה.שם יחידה.מזהה\""

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "הערת חריגה של מנפה השגיאות"

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "אל תכלול מסנן"

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "אל תכלול מסנן"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "ביצוע פקודה אחרי"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "ביצוע פקודה לפני"

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "הריצה הושעתה"

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "הריצה הושעתה s% כתובת: s%s%s% פרוצדורה: s%s% קובץ: s%s% (באחד הימים יופיע פה חלון של מהדר אסמבלי)"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "הריצה נעצרה"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "תוכנות"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "פרוש את כל המחלקות"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "פרוש את כל החבילות"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "פרוש את כל היחידות"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "הרחב את שם הקובץ של הקובץ הנוכחי שנערך"

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "ייצא ..."

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "ייצא רשימה"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "ביטוי:"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "ייצא את נתיב היחידה"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "חלץ"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "חלץ פרוצדורה"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "כלים חצוניים"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "נכשל בהרצת הכלי"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "הגעת לממספר הכלים המירבי"

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "למטה"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "למעלה"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "הסר"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "יש מקסימום של %s למספר הכלים"

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" הסתיים"

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "לא ניתן להריץ את הכלי %s%s%s:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "לא מצליח ליצור חבילת יישומים עבור \"%s\""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "נכשל בטעינת מצב מקופל"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "צמצם את צביעת המעצב"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "פריטי מעצב הצבעים מושבתים (צמצם אפשרויות עבור מחשבים איטיים)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "הקובץ s%s%s%s% לא נראה כמו קובץ טקסט. לפתוח אותו בכל זאת?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "הקובץ s%s%s%s% לא נראה כמו קובץ טקסט. לפתוח אותו בכל זאת?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "קובץ הרחבה של תכניות"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "מסנן קבצים"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "הקובץ s%s%s%s% השתנה. לשמור?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "לקובץ אין פרוייקט"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "הקובץ לא לכתיבה"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "הקובץ הוא קישור סימבולי"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "הקובץ s%s%s%s% הוא וירטואלי"

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "שגיאת קישור לקובץ"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "שם קובץ/כתובת"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "הקובץ לא נמצא"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "הקובץ s%s%s% לא נמצא"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "הקובץ s%s%s% לא נמצא. האם אתה רוצה ליצור אותו?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "הקובץ אינו באותיות קטנות"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "הקובץ אינו קובץ טקסט"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "הגדרות קובץ ..."

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "קבצים בקידוד ASCII  או UTF-8"

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "קבצים לא בקידוד ASCII  ולא UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "הקובץ בו נשמר המידע לניפוי שגיאות. אם אין הגדרה, המידע יכתב על מסך המסוף."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "מסנן"

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(מסנן)"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "מסנן: s%"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "הגדרת מסנן"

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "תלוי בריש&יות"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "אפשרויות ספרייה"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "מסכת קובץ (*.*,bak.*)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "כלול תיקיות משנה"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "דפוס רב שורות"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "רק קבצי טקסט"

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "ביטויים רגו&לריים"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "חפש את כל הקבצים בפרוי&יקט"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "חפש את כל הקבצים הפתוחים&"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "חפש בס&פריות"

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "טקסט לחיפוש:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "מיקום"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "מילים שלמו&ת בלבד"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "חפש צירופי מקשים"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "חפש יחידות חסרות"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "ראשון"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "תקן קובץ LFM"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "נקודה צפה"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "כפה שינוי שם"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "טופס"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "שגיאת מבנה"

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "שגיאה בטעינת טופס"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake נכשל"

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "רכיבים"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr " משאבי  FPC"

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "שגיאה בתיקיית קוד המקור של FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "גירסה ישנה מדי של FPC"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "גירסת FPC:"

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "גירסת FPC (למשל 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "עורך FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "שגיאה בכתיבת \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "שגיאת תחביר ב FPDoc"

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "יש שגיאת תחביר באלמנט של  fpdoc"

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "מצא רכיב לוח"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "מסגרת"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "חפש אחורנית"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "מהדר Free Pascal לא נמצא"

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "תכנית FPC המשתמשת ב TCustomApplication כדי לסמן בקלות אפשרויות של שורת הפקודה,טפול בחריגות, וכו. קוד התכנית מתוחזק אוטומטית ע\"י לזארוס."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "ספריית קוד המקור של Freepascal"

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "קובץ קוד ב FPC"

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "קובץ הקוד ב FPC לא נמצא"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "חיפוש קדימה"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "קבצים נוספים לחיפוש (כלומר /path/*.pas;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "מצא או שנה שם של מזהה"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "מצא מראי מקום"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "מזהה: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "בכל החבילות והפרוייקטים הפתוחים"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "ביחידה הנוכחית"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "בפרויקט הראשי"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "בפרוייקט/חבילה להם שייכת היחידה"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "מזהה לא חוקי"

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "שנה שם"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "שנה שם של כל מראי המקום"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "שנה שם ל"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "חפש גם בהערות"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "חפש היכן ש"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "פונקציה"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "קח את המילה שבמקום הנוכחי של הסמן"

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr "לך אל שורה"

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "לך לשורת הקוד שנבחרה"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך)  של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "קבוצה"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "הגדל לגדול ביותר"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "יש לו עזרה"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "הערת כותרת למחלקה"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "כניסות עזרה"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "בורר העזרה"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "הקסדצימלי"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "עזרה להודעות שגיאה של מהדר FPC"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr "הסתר הודעה דרך הוראת מהדר"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "טיפ: ניתן להגדיר ערך ברירת מחדל בהתניות עם:"

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "טיפ: בדוק אם יש שתי חבילות המכילות יחידות עם אותו שם."

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "טיפ: לחץ לחיצה כפולה על הפקודה שאתה רוצה לערוך"

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "פתח"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "השהיה"

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "ריצה"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "שמור"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "שמור הכל"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "צעד לתוך"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "הרץ עד לחזרה מפונקציה"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "צעד מעבר ל"

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "עצור"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "טיפ: הפונקציה \"Make Resourcestring\" מקבלת מחרוזת קבועה. בחר ביטוי ונסה שוב."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "טיפ: הפונקציה \"Make Resourcestring\" מקבלת מחרוזת קבועה. בחר רק מחרוזת ונסה שוב."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "החלף טופס/יחידה"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "הצג טפסים"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "הצג יחידות"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "ספירת טיפים"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "בסיס נתונים"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "אפשרויות עזרה"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "תכונות:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "תצוגות"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "נתיב ל FPC Doc HTML"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "אופקי"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "אפשרויות הבניה של ה IDE "

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "יוצר Makefile עבור חבילה %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "שגיאה: הרצת כלי \"הדר אחרי\" נכשלה עבור חבילה %s"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "מידע על ה IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "אזהרה: שם יחידה לא חוקי %s, חבילה=%s"

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "ממשק ה IDE "

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "מזהה"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "מזהה המתחיל עם ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "מזהה מכיל ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "אפשרויות IDE"

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "הראה את תיקיית הפרוייקט בכותרת של ה IDE "

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "הכותרת של ה IDE מתחילה בשם הפרוייקט"

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "שגיאה בגישה ל xml"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "שגיאה בגישה לקובץ xml %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "שגיאה בטעינת xml"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "שגיאה בטעינת קובץ xml %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "הקובץ המיוצא קיים"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "הקובץ המיוצא s%s%s%קיים. לפתוח את הקובץ ולהחליף רק את אפשרויות המהדר? ( יתר ההגדרות יישמרו.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "טען מקובץ"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "פתח או טען אפשרויות מהדר"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "פתח אחרונים"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "קבצים אחרונים"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "שמור לקובץ"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "שמור את המצב הקודם האחרון"

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "אשר"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "התעלם מהכל"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "התעלם והמשך"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "התעלם מבינארי"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "התעלם מסוג חריגות זה"

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "התעלם מהקובץ החסר"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "התעלם, השתמש ב TForm כמחלקה הראשונית"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "העתק זיהוי של היחידה , הפרוייקט או החבילה הנוכחיים."

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "הערת מימוש של המחלקה"

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "ייבא רשימה"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "בלתי אפשרי"

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "כלול מסנן"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "כלול נתיב"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "כלול נתיבים"

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "זיהוי"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "זיהוי לקוד פסקל"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "אינדקס"

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr "מבוטל ..."

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "הדר פרויקט"

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "מהדר..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr "שגיאה..."

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "שגיאות:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "טיפים:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "שורות:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "בטל"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "הערות:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "פרוייקט:"

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "הצלחה ..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "אזהרות:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "מידע"

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "מידע עבור %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "מידע על  FPC"

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "לפני הקשורים"

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr "רכיב מורש"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "פריט מורש"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "כדי ליצור העתק נקי של הפרוייקט/חבילה, כל הקבצים בתיקייה הבאה יימחקו וכל התוכן יאבד. האם למחוק את כל הקבצים ב s%s%s%?"

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "הכנס תאריך"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "הכנס תאריך ושעה"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "הכנס תאריך ושעה. אפשרי: עיצוב המחרוזת"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "הכנס תאריך. אפשרי: עיצוב המחרוזת"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "הכנס סיום אם צריך"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "הכנס מאקרו"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "הכנס את שם הפרוצדורה הנוכחית"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "הכנס תוית PrintShort"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "הכנס תוית printshort"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "הכנס את כותרת הפרוצדורה"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "הכנס את שם הפרוצדורה"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "הכנס שעה"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "הכנס שעה. אפשרי: עיצוב המחרוזת"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "הכנס תוית url"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "פקח"

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "נתונים"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "מפקח המהדר"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "מתודה"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "תכונות"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "ההתקנה נכשלה"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "התקן זאת,אני אוהב אותו שמן"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "התקן את מה שנבחר"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr "התקן/הסר חבילות"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "אינטראקטיבי"

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr "מקרו בניה לא חוקי %s%s%s . מאקרו בניה חייב להיות מזהה פסקל."

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr "מקרו בניה לא חוקי %s%s%s . שם המאקרו הוא מלה שמורה.."

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "עיגול לא תקין"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "פקודה לא חוקית"

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "שם מהדר לא חוקי"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "מחיקה לא חוקית"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "תיקיית יעד לא חוקית"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "ביטוי לא חוקי: s%s%s%"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "ביטוי לא חוקי: הפונקציה \"Make Resourcestring\" מצפה למחרוזת קבועה בקובץ יחיד. בחר את הביטוי ונסה שוב."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "מסנן לא חוקי"

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "תיקיית קוד מקור לא חוקית של Free Pascal "

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "שורה לא חוקית, עמודה בהודעה s%s%"

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "אופן לא חוקי %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "בחירה מרובה לא חוקית"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "לא חוקי (מכובה)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "לא חוקי (מופעל)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "מזהה פסקל לא חוקי"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "השם s% אינו מזהה חוקי של פסקל."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "שם פרוצדורה לא חוקי"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "שם קובץ של הפרוייקט לא חוקי"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "תיקיית פרסום לא חוקית"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "בחירה לא חוקית"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr "זוהי קבוצה. אפשר רק להוסיף הגדרות למצבי בניה נורמלים."

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "זה כבר חלק מהפרוייקט. s%"

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "זה שם פרוייקט לא חוקי %s%s%s. בחר שם אחר (למשל project1.lpi)"

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "תלות מעגלית זאת אסורה"

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr "היסטוריית קפיצות"

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "טופס JIT"

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "שמור "

#: lazarusidestrconsts.liskeepfileopen
#, fuzzy
#| msgid "Keep converted file open in editor"
msgid "Keep converted files open in editor"
msgstr "שמור את הקובץ שהומר פתוח בעורך"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "כל קבצי הפרוייקט ישארו פתוחים בעורך אחרי ההמרה"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "שמור ברשימת ההתקנות"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "שמור שם"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "שמור אותם והמשך"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "פקודות מותאמות אישית"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "פקודות מעצב"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "פקודות מפקח העצמים"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "מפתח (או סדרה של שני מפתחות)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "בטל בנייה"

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "הוסף את היחידה הפעילה לפרויקט"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "הוסף משגיח"

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "בנה את כל הקבצים של התכנית/פרוייקט"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "בנה את התכנית/פרוייקט"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "בחר סכמת מיפוי מקשים"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "קלאסי"

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "סגור הכל"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "סגור פרויקט"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "הגדרת עורך ע\"י CodeTools"

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "אפשרויות CodeTools"

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "אפשרויות מהדר"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "ארגן ובנה את קובץ s%"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "מגדיר רכיבים מותאמים אישית"

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "הגדר עזרה"

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "התקן/הסר חבילות"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "עזרה רגישה להקשר"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "החלף חבילת דלפי לחבילת לזארוס"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "החלף פרוייקט דלפי לפרוייקט לזארוס"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "החלף יחידת דלפי ליחידת לזארוס"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "החלף DFM ל  LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "העתק את הרכיבים הנבחרים ללוח הזמני"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "גזור את הרכיבים שנבחרו אל הלוח הזמני"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "מחק את התו האחרון"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "עורך להשוואת קבצים"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "ערוך תבניות קוד"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "ערוך עזרה רגישה להקשר"

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "אפשרויות עורך"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "צרף את הבחירה"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "חשב/שנה"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "הגדרת כלים חצוניים"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "מצא באופן מתקדם"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "לך לסימן 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "לך לסימן 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "לך לסימן 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "לך לסימן 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "לך לסימן 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "לך לסימן 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "לך לסימן 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "לך לסימן 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "לך לסימן 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "לך לסימן 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "לך לעורך קוד 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "לך לעורך קוד 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "לך לעורך קוד 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "לך לעורך קוד 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "לך לעורך קוד 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "לך לעורך קוד 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "לך לעורך קוד 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "לך לעורך קוד 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "לך לעורך קוד 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "לך לעורך קוד 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "הכנס תאריך ושעה"

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "הכנס IFDEF$"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "הכנס שם משתמש"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "פקח"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "סכמת מיפוי מקשים"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "לזארוס (ברירת מחדל)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "(סגנון אפל גירסה 10) Mac OS X"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "(סגנון לזארוס) Mac OS X"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "חבילה חדשה"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "פרויקט חדש"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "פרויקט חדש מקובץ"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "יחידה חדשה"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "הערה: כל המקשים יוגדרו לערכים של הסכמה הנבחרת."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "לפתוח קובץ חבילה"

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "גרף החבילות"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "הדבק את הרכיבים מהלוח הזמני"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "השהה תוכנית"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "פרסם פרויקט"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "הידור מהיר ללא קישור"

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "הסר את היחידה הפעילה מהפרוייקט"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "הרץ תוכנה"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "שמור הכל"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "שמור כ"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "שמור פרוייקט"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "שמור פרוייקט כ "

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "בחר את סוף השורה"

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "בחר את התחלת השורה"

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "בחר את תחתית הדף"

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "בחר את ראש הדף"

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "בחר את שמאל המילה"

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "בחר את ימין המילה"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "קבע סימניה חופשית"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "קבע סמן 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "קבע סמן 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "קבע סמן 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "קבע סמן 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "קבע סמן 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "קבע סמן 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "קבע סמן 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "קבע סמן 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "קבע סמן 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "קבע סמן 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "עצור תכנית"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "החלף בין יחידה לטופס"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "החלף סמן 0"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "החלף סמן 1"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "החלף סמן 2"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "החלף סמן 3"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "החלף סמן 4"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "החלף סמן 5"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "החלף סמן 6"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "החלף סמן 7"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "החלף סמן 8"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "החלף סמן 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr "החלף (הצג/הסתר) מהדר האסמבלי"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "החלף (הצג/הסתר) נקודות עצירה"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "החלף (הצג/הסתר) קריאות למחסנית"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "החלף (הצג/הסתר) סייר הקוד"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "החלף (הצג/הסתר) לוח הרכיבים"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr "החלף (הצג/הסתר) לוג ארועי מנפה השגיאות"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "החלף (הצג/הסתר) פלט מנפה השגיאות"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "החלף (הצג/הסתר) עורך התיעוד"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "החלף (הצג/הסתר) לחצנים מהירים של ה IDE"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "החלף (הצג/הסתר) משתנים מקומיים"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "החלף (הצג/הסתר) הודעות"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "החלף (הצג/הסתר) צופה העצמים"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr "החלף (הצג/הסתר) אוגרים"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "החלף (הצג/הסתר) תוצאות חיפוש"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "החלף (הצג/הסתר) את עורך הקוד"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "החלף (הצג/הסתר) משגיחים"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "הצג היסטורית הקפיצה"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "הצג אפשרויות הפרויקט"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "הצג קוד הפרויקט"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "הצג מידע על היחידה"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "טעינת היישום לא חוקית"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "טעינת שורת הפקודה המיועדת"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "הגדרות שולחן העבודה של לזארוס"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "הספרייה של לזרוס"

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "תיקיית לזארוס לא נמצאה"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "התקייה, שיש להשתמש בה כתיקיית המוצא"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "לזרוס IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "קובץ לזארוס"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "טופס לזארוס"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "לזארוס IDE"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "קובץ \"כלול\" של לזארוס"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "מזהה השפה של לזרוס (למשל: en, de, br,fi, he)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "שם השפה של לזרוס (למשל english, deutsch, hebrew)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "לזארוס [אפשרויות] <פרוייקט-שם קובץ>"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "חבילת לזארוס"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "פרוייקט לזארוס"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "קובץ מידע של פרוייקט לזארוס"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "קובץ קוד של פרוייקט לזארוס"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "יחידת לזארוס"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "פעולה"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "בחר בתיקיית הפלט לקבצי הריצה של הIDE"

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "חלק"

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "הוסף"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "אפשרויות בניה מתקדמות"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "האם אתה בטוח שאתה רוצה למחוק את פרופיל הבנייה הזה?"

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "בנה"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr "בנייה מתקדמת"

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "בנה את CodeTools"

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "רכיבי בניה (SynEdit, CodeTools)"

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "בנה את הדוגמאות"

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "בנה את ה IDE"

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "בנה JITForm"

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "בנה SynEdit"

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "נקה הכל"

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "נקה ובנה"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "הגדרות משותפות"

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr "הדר את החבילות הסטטיות לתוך הקובץ הבינארי של לזארוס"

#: lazarusidestrconsts.lislazbuildconfirmbuild
#, fuzzy
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "אשר לפני בנייה מחודשת של לזרוס"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "אשר מחיקה"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr ""

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "שגיאה בכתיבת קובץ"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "בונה לזארוס אינו אינטראקטיבי, יוצא עכשיו."

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr "כמו \"make clean\" בשורת הפקודה"

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "נהל פרופילי בנייה "

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "נהל פרופילים"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "שם הפרופיל הפעיל"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "הוסף פרופיל חדש"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "אפשרויות הבנייה הנוכחיות יקושרו עם:"

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "ללא"

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "אשר"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "אפשרויות:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "אפשרויות שהועברו למהדר"

#: lazarusidestrconsts.lislazbuildprofile
#, fuzzy
#| msgid "Build Profile"
msgid "Profile to Build"
msgstr "פרופיל בנייה"

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr "בנה הכל"

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "בנה את ה IDE ללא חבילות"

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "בנה את ה IDE עם חבילות"

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "בנה את LCL"

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "נקה ובנה הכל"

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "לרענן"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "הסר"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "שנה שם"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "שנה שם הפרופיל"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "שם חדש לפרופיל:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
#, fuzzy
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "אתחל אחרי בנייה מוצלחת"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "אתחל את לזארוס אוטומטית אחרי בניית ה IDE. (אין לזה השפעה בזמן בניית חלקים אחרים)"

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "שמור הגדרות"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "בחר פרופילים לבנייה"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "הראה דיאלוג אישרור כשאתה בונה ישירות מתפריט \"כלים\""

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "מעבד היעד:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "תיקיית היעד:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "מערכת ההפעלה המיועדת"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "לא יכול לכתוב את הקובץ s%:%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "עדכן את revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "עדכן את מידע התיקון בדיאלוג \"About Lazarus\""

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr "עם החבילות"

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "הנתיב של יחידת LCL חסר"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "עצם מסוג LCL"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "הוסף קישור לירושה"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "העתק מהירושה"

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "אין נתיב חוקי של LazDoc. לא יכול ליצור קובץ fpdoc עבור s%"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "הזז ערך ליורש"

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "הנתיב של LazDoc אינו תקין"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "היחידה s% אינה בבעלות חבילה או פרוייקט כלשהם. הוסף את היחידה לחבילה או לפרוייקט. לא יכול ליצור את קובץ ה fpdoc."

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "השאר ריק עבור קובץ po. ברירת המחדל"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "שמאל"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "רווח גבול שמאלי. הערך מתווסף לרווח הגבול הבסיסי ומשמש לרווח שמשמאל לפקד."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "עיגון לשמאל"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "זהו פקד אח אליו מעוגן הצד השמאלי. השאר ריק עבור הורה."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "צדדים שמאליים"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "רווח  במדה שווה משמאל"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "רמות"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "קובץ LFM "

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "קובץ LFM הרוס"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "קובץ LFM תקין"

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך)  של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "ספריה s% ספריית Free Pascal (תחת ווינדוס dll. , תחת לינוקס so. תחת מאק dylib.). קוד הספריה מתוחזק אוטומטית ע\"י לזארוס."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "נתיב הספריה"

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "שורה:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "שורה/אורך"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "קישור:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "אפשרויות מקשר"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "קשר יעד"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "רשימה של כל ערכי case"

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "טעינת s% נכשלה"

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "מקומיים"

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "שם"

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "ערך"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr "הודעת לוג"

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "לוגו"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "מחרוזת של אותיות קטנות"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "מחרוזת של אותיות קטנות נתונה כפרמטר"

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "קובץ \"כלול\" מסוג lrs"

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "פסקל של מאק"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "מאקרו %s"

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr "שם מאקרו"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "הזן מידע"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "הזן פרמטרים לריצה"

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr "ערך מאקרו"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "ליחידה הראשית יש יישום. משפטי CreateForm"

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "ליחידה הראשית יש יישום. משפטי כותרת"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "ליחידה הראשית יש קטע הכולל את כל יחידות הפרוייקט"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "היחידה הראשית היא קוד של פסקל"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "קובץ ריצה של Make"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "קובץ Make לא נמצא"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "מחרוזת המשאבים של Make"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "הוסף אחרי הקטע"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "מחרוזת המשאבים s%s%s% כבר קיימת. בחר שם אחר.השתמש ב\"התעלם\" כדי להוסיף אותו בכל זאת."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "אפשרויות המרה"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "מזהה מותאם אישית"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "מזהה"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "אורך המזהה"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "קידומת מזהה:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "הוסף לפי א' ב'"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "הכנסה רגישת הקשר"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "קטע מחרוזת משאבים לא חוקי"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "אנא בחר איזור של מחרוזת משאבים מהרשימה"

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "מחרוזת המשאבים כבר קיימת"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "קטע מחרוזת המשאבים:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "תצוגה מקדימה של הקוד"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "מחרוזת קבועה בקוד"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "מחרוזת בעלת אותו ערך"

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "מקסימום d%"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "השלכת זיכרון"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "בטל בנייה"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "אודות FPC"

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "נקודת עצירה בקוד"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "הוסף נקודת עצירה"

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "הוסף את היחידה הפעילה לחבילה"

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "הוסף נקודת קפיצה להיסטוריה"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "הוסף את קבצי העורך לפרויקט"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "הוסף משגיח ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "חתוך את השורה במקום שנבחר"

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "בנה"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "בנה הכל"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "בנה קובץ"

#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "בנה את לזרוס"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr "בנה את לזארוס עם הפרופיל: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "בדוק את קובץ הLFM בעורך"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "נקה ספרייה ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "סגור"

#: lazarusidestrconsts.lismenucloseall
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "סגור את כל הקבצים בעורך"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "סגור פרויקט"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "הגדרת עורך ע\"י CodeTools"

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "אסוף קבצי po."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "בחירת הערה"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "אפשרויות מהדר ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "השלם קוד"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "הכנס $IFDEF..."

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "מגדיר את קובץ בנה והרץ ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "מגדיר רכיבים מותאמים אישית ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "הגדר כלים חיצוניים"

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "מגדיר \"בנה לזרוס\""

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "הגדר עזרה ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "עזרה רגישת הקשר"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "המר חבילת דלפי לחבילת לזארוס"

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "המר פרוייקט דלפי לפרוייקט לזארוס"

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "המר יחידת דלפי ליחידת לזארוס"

#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "המר קובץ בינארי  DFM לקובץ בינארי LFM ובדוק תחביר ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "המר את קידוד הפרויקט/חבילה ..."

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "העתק"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "צור קבצי FPDoc"

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "צור קבצי po."

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "חתוך"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "חלון ניפוי שגיאות"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "השווה"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "ע&ריכה"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "תבניות קוד ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "ערוך עזרה רגישת הקשר"

#: lazarusidestrconsts.lismenueditinstallpkgs
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "התקן/הסר חבילות ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr "עורך תפריטים"

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "צור תפריט משנה"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "מחק מהתבנית ..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "מחק פריט"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "טפל בארוע OnClick"

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "הכנס מתבנית ..."

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "הכנס פריט חדש (אחרי)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "הכנס פריט חדש (לפני)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "עורך תפריטים"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "הזז למטה (או לימין)"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "הזז למעלה (או לשמאל)"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "תאור תבנית חדש..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "שמור כתבנית ..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "בחר תפריט:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "בחר תבנית:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "תצוגה מקדימה של תבניות"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "צרף את הבחירה"

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "ס&ביבה"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "הערכה/שינוי ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "חלץ פרוצדורה ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "קובץ&"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "מצא"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "מצא& ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "מצא סיום אחר של בלוק קוד"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "מצא התחלת בלוק קוד"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "מצא הצהרה שבמקום הסמן"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "מצא מקורות המזהה"

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "מצא בקבצים ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "מצא את הבא"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "מצא את הקודם"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "עורך FPDoc"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "אפשרויות ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "לך להוראת \"כלול\""

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "לך לשורה"

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "נחש שגיאות במיקום IFDEF/ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "נחש בלוקים לא סגורים"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "עזרה&"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "תכונות פנימיות של ה IDE"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "חיפוש מתקדם"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "הזך בחירה"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "רשומה ביומן השינויים"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "הכנס ממפת התווים"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "מלת מפתח של CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "תאריך ושעה נוכחיים"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "כללי"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "הערת GPL"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "הערת LGPL"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "הערת LGPL מותאמת"

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "הכנס טקסט"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "שם המשתמש הנוכחי"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "פקח ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "קפוץ אחורה"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "קפוץ קדימה"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "קפוץ אל"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "קפוץ אל הסימניה הבאה"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "קפוץ אל השגיאה הבאה"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "קפוץ אל הסימניה הקודמת"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "קפוץ אל השגיאה הקודמת"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "בחירת אותיות קטנות"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "צור מחרוזת משאבים ..."

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "טופס חדש"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "חדש ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "חבילה חדשה ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "פרויקט חדש ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "פרויקט חדש מקובץ ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "יחידה חדשה"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "עזרה מקוונת"

#: lazarusidestrconsts.lismenuopen
#| msgid "Open ..."
msgid "&Open ..."
msgstr "פתח ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "פתח שם קובץ במיקום הסמן"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "פתח חבילה טעונה ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "פתח קובץ חבילה (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "פתח את החבילה של היחידה הנוכחית"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "פתח פרויקט ..."

#: lazarusidestrconsts.lismenuopenrecent
#, fuzzy
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "פתח אחרונים ..."

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "פתח חבילות אחרונות ..."

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "פתח פרויקטים אחרונים ..."

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "ח&בילה"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "גרף החבילות ..."

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "קישורי חבילה ..."

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "הדבק"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "השהה"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "רשימת פרוצדורות"

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "פרויקט&"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "מפקח פרוייקט"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "אפשרויות פרויקט ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "הרץ"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "פרסם פרויקט..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "הידור מהיר"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "בדיקת תחביר מהירה"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "בדיקת תחביר מהירה תקינה"

#: lazarusidestrconsts.lismenuquit
#| msgid "Quit"
msgid "&Quit"
msgstr "צא"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "בצע שוב"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "הסר מהפרוייקט"

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "שנה שם מזהה"

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "החלף"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "החלף&"

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "דיווח באגים ..."

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "סרוק שוב את תיקיית FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "אתחל את מנפה השגיאות"

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "אתחל"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "שחזר"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "ה&רץ"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "הרץ קובץ"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "הרץ פרמטרים ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "רוץ עד לסמן"

#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "שמור"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "שמור הכל"

#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "שמור כ ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "שמור פרוייקט"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "שמור פרוייקט כ ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "חפש&"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "בחר"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "בחר הכל"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "בחר בלוק קוד"

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "בחר שורה"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "בחר קטע"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "בחר עד לסוגריים"

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "בחר מילה"

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "קבע סימניה חופשית"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr "הראה נקודת ביצוע"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "סדר את הבחירה ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "קפוץ לתוך"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr "צעד לתוך (הקשר)"

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr "צעד לתוך ההוראה"

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr "צעד לתוך ההוראה"

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr "קפוץ החוצה"

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "קפוץ מעבר ל"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr "צעד מעבר (הקשר)"

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr "צעד מעבר להוראה"

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr "צעד מעבר להוראה"

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "עצור"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "החלף טאבים לרווחים בבחירה"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "אודות"

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "סגור"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "מכיל"

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "העתק"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "חתוך"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "תפריט ערוך סטנדרטי"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "תפריט קובץ סטנדרטי"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "תפריט עזרה סטנדרטי"

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "עריכה"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "יציאה"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "קובץ"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "מצא"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "מצא את הבא"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "עזרה"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "חדש"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "פתח"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "פתח אחרונים"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "הדבק"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "בצע שוב"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "שמור"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "שמור כ"

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "מדריך"

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "בטל פעולה"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr "הצג (הראה/הסתר) הערות"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "כלים&"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "בטל את סימון הבחירה כהערה"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "בטל"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "בטל את זיהוי הבחירה"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "בחירה באותיות ראשיות"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "הצגה&"

#: lazarusidestrconsts.lismenuviewanchoreditor
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "עורך המעגנים"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "נקודות עצירה"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "קרא למחסנית"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "סייר הקוד"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "סייר קוד"

#: lazarusidestrconsts.lismenuviewcomponentpalette
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "פלטת הרכיבים"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "ר&כיבים"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "דו\"ח איורעים"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "פלט ניפוי השגיאות"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "טפסים ..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "כפתורי ה Speed ב IDE"

#: lazarusidestrconsts.lismenuviewjumphistory
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "היסטורית הקפיצות ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "משתנים מקומיים"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "הודעות"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "מפקח עצמים"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "אוגרים"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "סייר הגבלות"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "תוצאות חיפוש"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "הצג בקוד&"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "עורך קוד מקור"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "רשימת \"לעשות\""

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "החלף בין הצגת טופס/יחידה"

#: lazarusidestrconsts.lismenuviewunitdependencies
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "תלויות היחידה"

#: lazarusidestrconsts.lismenuviewunitinfo
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "מידע על היחידה"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "יחידות..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "משגיחים"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "חל&ון"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr "ההודעה אינה מכילה מידע על מיקום הקובץ: s%s%"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "עורך הודעות"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "מחלקת המתודה לא נמצאה"

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "ארועים חסרים"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "המזהים אינם קיימים"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "חבילות חסרות"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "האפשרויות שלך הן:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "הסר סימון"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "עבור דלפי בלבד"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) הסר סימון מהיחידות שנבחרו."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) השתמש ביחידות רק עבור דלפי"

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) חפש יחידות. הנתיבים שנמצאו הוספו להגדרות הפרוייקט."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) צא עכשיו, התקן חבילות או תקן את הנתיב ונסה שוב."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "חפש את נתיב היחידה"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<תאור> s% זכויות יוצרים (C) <שנה> <שם המחבר> <התקשרות> s% קוד זה הוא תכנה חפשית; אתה רשאי להפיץ ו/או לשנות אותה בהתאם לתנאים של GNU GPL כמו שפורסמו ע\"י הקרן למען תכנה חפשית; לפי גרסה 2 או לפי גרסה מאוחרת יותר (לפי בחירתך)  של הרשיון. קוד זה מופץ בתקווה שיהיה שימושי, אבל ללא אחריות כלשהי; אפילו לא אחריות שיווקית או התאמה לתכלית מסוימת. ראה GNU GPL לפרטים נוספים. ניתן למצוא ברשת את הרשיון בכתובת <http://www.gnu.org/copyleft/gpl.html>.או לקבל אותו ע\"י כתיבה ל the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "שנה"

#: lazarusidestrconsts.lismore
msgid "More"
msgstr "עוד"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "הזז  \"%s\" מיקום אחד למטה"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "הזז  \"%s\" מיקום אחד למעלה"

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "הזז דף ..."

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "שמור הודעות לקובץ (*.txt)"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "התנגשות בין שמות"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "שם הפרוצדורה החדשה"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "אף פעם"

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "חדש"

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "אבות חדשים"

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "אופן בניה חדש"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "מחלקה חדשה"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "יישום מסוף חדש"

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "צור יישום CGI חדש. קוד היישום מתוחזק ע\"י לזארוס."

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "צור תוכנה חדשה."

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "צור קובץ עורך חדש. %sבחר סוג."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "צור קובץ טקסט ריק"

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "צור יישום גרפי חדש. קוד היישום מתוחזק על ידי לזרוס."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "צור יחידת פסקל חדשה."

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "צור תוכנה חדשה. קוד התוכנה מתוחזק על ידי לזרוס."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "צור פרויקט חדש.%sבחר סוג."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "צור חבילה סטנדרטית חדשה.%sחבילה היא אוסף של יחידות ורכיבים."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "צור יחידה חדשה עם datamodule."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "צור יחידה חדשה עם מסגרת."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "צור יחידה חדשה עם טופס LCL."

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "ירש מרכיב קיים"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "לא נבחר פריט"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "אנא בחר פריט מהרשימה"

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "קידוד חדש:"

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr "קבוצה חדשה - ערכת סגנונות"

#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "פרוייקט חדש - s%"

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "הגדרות חדשות"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr "יחידות חדשות נוספו לאזור \"משתמש ב\":"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "לא"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "ללא קבצי גיבוי"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "לא נבחר פרופיל לבנייה"

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "אין שינוי"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "לא נבחר קוד"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "לא נורשו אפשרויות המהדר."

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr "אין שגיאות"

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "אין טיפים"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "לא נבחר חלון IDE"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "אין קובץ LFM"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "לא נבחר מאקרו"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "ללא שם"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "ללא"

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "ללא"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "ללא, הקלק כדי לבחור אחד"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "לא נבחרה צומת"

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "אין קובץ פסקל"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "אף קובץ תכנית %s%s%s לא נמצא"

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "לא נמצא אזור של מחרוזת משאבים"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "בדרך כלל מסנן הוא ביטוי רגולרי. בתחביר רגיל . היא תו רגיל, * מצינת כלשהו, ? מציינת תו בודד כלשהו, ופסיק ו ; מפרידים בין אפשרויות. לדוגמה: בתחביר פשוט*.pas;*.pp  מתאים ל ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "לא נמצאו מחרוזת קבועות"

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "זה אינו פרוייקט דלפי"

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "זו אינה יחידת דלפי"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "לא חבילה להתקנה"

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "זה אינו מזהה פסקל חוקי"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "הערה: לא יכול להגדיר תבנית עבור קוד Free Pascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "הערה: לא יכול להגדיר תבנית עבור קוד לזארוס"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "לא ממומש"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "לא ממומש עדיין: %s%s"

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "לא ממומש עדיין."

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "לא עכשיו"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "צור"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "צור פרויקט חדש"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "בחר סוג פרויקט"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "מספר הקבצים להמרה: %s"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal ברירת מחדל"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "נתיב האובייקט"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "עבור למפקח העצמים ללשונית מועודפים"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "עבור למפקח העצמים ללשונית מועודפים אחרי בקשה לשם רכיב"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (כבוי)"

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "להוסיף לתכונות המועדפות"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "בחר במחלקה בסיסית עבור תכונת המועדפים %s%s%s"

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "המחלקה %s%s%s לא נמצאה"

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "הסר מתכונות מועדפות"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "התקן אוטומטית באופן דינמי"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "התקן אוטומטית באופן סטטי"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "תאור:"

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "תאור: s%"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "שם קובץ: s%"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "הותקן באופן דינמי"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "הותקן באופן סטטי"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "חסר"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "שהשתנה"

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "לא נבחרה חבילה"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "פתח חבילה טעונה"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "שם החבילה"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "אנא בחר בחבילה"

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "אנא בחר חבילה לפתוח"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "קריאה בלבד"

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "מצב"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "חבילה זאת מותקנת, אבל קובץ ה lpk לא נמצא"

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "חבילה זאת נוצרה אוטומטית"

#: lazarusidestrconsts.lisok
#| msgid "&Ok"
msgid "&OK"
msgstr "א&שר"

#: lazarusidestrconsts.lisold
msgid "old"
msgstr "ישן"

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "אב קדום"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "מחלקה קדומה"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (דלוק)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "בסוף השורה (למשל: מקש  return או enter)"

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "חפש רק מילים שלמות"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "בהעתקה מהלוח הזמני"

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr "פתח..."

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "פתח כקובץ XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "פתח מעצב או פתח יחידה"

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "פתח קובץ קיים"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "פתח קובץ"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "פתח קובץ ..."

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "פתח %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "לפתוח חבילה?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "פתח חבילה %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "לפתוח קובץ חבילה"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "לפתוח פרויקט?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "פתח פרויקט"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "לפתוח פרויקט בשנית"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "לפתוח את קובץ הפרויקט"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "פתח symlink"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "פתח את המטרה"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "פתח את הקובץ כקוד מקור נורמאלי"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "האם לפתוח את החבילה %s?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "האם לפתוח את הפרויקט %s?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "או"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "מעמיס על השפה. דוגמא: language=he--. בשביל לקבל רשימה של ערכים אפשריים ראה את הקבצים בספריית השפות."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "דרוס את מהדר ברירת המחדל לדוגמא ppc386 ppcx64 ppcppc וכו'. מהדר ברירת המחדל מאוחסן בקובץ environmentoptions.xml"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr "החלף את אופן הבנייה של הפרוייקט"

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "דרוס את מעבד ברירת המחדל של הפרוייקט לדוגמא ppc386 ppcx64 ppcppc וכו'. ברירת המחדל: s%"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "דרוס את מערכת ההפעלה שהיא ברירת המחדל לדוגמא win32 linux. ברירת המחדל: s%"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "דרוס את מערכת העצמים של הםרוייקט  לדוגמא gtk gtk2 qt win32 carbon. ברירת המחדל: s%"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "האם לשכתב את הקובץ מחדש?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "משכתב את הקובץ מחדש על דיסק"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "\"הבעלים\" כבר בשימוש ע\"י TReader/TWriter. בחר שם אחר."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "חבילה"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "חבילה s%"

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "מידע על החבילה"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "שם החבילה מתחיל ב ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "שם החבילה מכיל ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "החבילה לא נמצאה"

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "החבילות להתקנה בIDE"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "יחידה של החבילה"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr "פרוש"

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "קובץ קוד של פסקל"

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "יחידה של פסקל"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "ספירת מעברים"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "הדבק את מה שבלוח הזמני"

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "הדבק את הטקסט שבלוח הזמני"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "נתיב"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "דפדף"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "הזז נתיב למטה"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "הזז נתיב למעלה"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "נתיב תבניות"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "נתיב חיפוש:"

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "בחר ספרייה"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "נתיב של שרותי make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "נתיב אל מופע שנכשל:"

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "הוסף עצם"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "הוסף לפרוייקט"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "בצע שינויים"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "קרא לפרוצדורת הרישום של היחידה שנבחרה"

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "נקה את שם קובץ ברירת המחדל/מועדף של התלות"

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "הדר"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "להדר הכל?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "הדר חבילה"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "אפשרויות מהדר לחבילה %s"

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "אפשרויות מהדר"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "צור makefile"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "ברירת מחדל"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "תכונות התלות"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "ערוך אפשרויות כלליות"

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "ערוך אפשרויות להידור חבילה"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "תכונות קובץ"

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "אפשרויות כלליות"

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "עזרה"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "התקן"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "התקן חבילה ב IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "גירסה מקסימלית לא חוקית"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "גירסה מינימלית לא חוקית"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "גירסה מקסימלית:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "גירסה מינימלית"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "השתנה: s%"

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "עוד ..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "הזז תלות למטה"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "הזז תלות למעלה"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "חבילה %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "חבילה s%s%s% השתנתה. האם לשמור את החבילה?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "החבילה %s לא נשמרה"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "עמוד: s%"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "הוסף תלות מחדש"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "הוסף קובץ מחדש"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "קריאה בלבד: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "הדר מחדש את כל מה שדרוש"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "נקה הידור מחדש"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "הדר זאת וכל החבילות הדרושות מחדש?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "תוספי רישום"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "יחידת רישום"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "הסר תלות"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "הסר תלות?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "הסר תלות s%s%s% מחבילה s%s%s%?"

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr " קבצים הוסרו (קבצים אלו לא נשמרו בקובץ ה lpk.)"

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "חבילות דרושות שהוסרו (חבילות אלו לא נשמרו בקובץ ה lpk.)"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "הסר קובץ"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "להסיר את הקובץ?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "הסר קובץ s%s%s% מחבילה s%s%s%?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "הסר את הפריט הנבחר"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "חבילות דרושות"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "לשמור שינויים?"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "שמור חבילה"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "אחסן את שם הקובץ כברירת מחדל בתלות זאת"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "אחסן את שם הקובץ כמועדף בתלות זאת"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "הגירסה המקסימלית s%s%s% היא לא גירסה חוקית של החבילה. (דוגמה נכונה 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "הגירסה המינימלית s%s%s% היא לא גירסה חוקית של החבילה. (דוגמה נכונה 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "הסר התקנה"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "הצג בקוד החבילה"

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "נוצר אוטומטית"

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "מותקן"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "התקן בהתחלה הבאה"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "החבילה שנבחרה דרושה ע\"י:"

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "חבילות טעונות:"

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "החבילה %s לא נמצאה"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "מצב"

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "הסר התקנה בהתחלה הבאה"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "הוסף אפשרויות לפרוייקטים וחבילות תלויות"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "הוסף נתיבים לתלויות החבילות/פרוייקטים"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "מחבר:"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "הגדל אוטומטית את הגירסה בזמן הבניה"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "בנה אוטומטית מחדש כשצריך"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "בנה אוטומטית מחדש בבנית הבל מחדש"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "מותאם אישית"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "תאור/הפשטה"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "זמן עיצוב וזמן ריצה"

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "זמן עיצוב בלבד"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "אינטגרציית IDE"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "הוסף"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "סוג חבילה לא חוקי"

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "נתיב של קבצי FPDoc"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "ספריה"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "רשיון:"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "מקשר"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "ראשי"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "הידור ידני (אף פעם לא אוטומטי)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "משני"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "אובייקט"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "אפשרויות חבילה"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "סוג חבילה"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "מספק"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "הפצה"

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "רק בזמן ריצה"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "לחבילה s%s%s% יש דגל של התקנה אוטומטית.כלומר היא תותקן ע\"י ה  IDE. חבילות ההתקנה חייבות להיות חבילות זמן עיצוב."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "חבילה זאת מספקת אותם דברים כמו החבילות הבאות:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "עדכן/בנה מחדש"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "שימוש"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "בטל"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "התקדמות"

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "נמצאה התנגשות"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "ערוך יחידה וירטואלית"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "שם קובץ:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "תקן את רישיות האותיות בקבצים"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "שם קובץ יחידה לא חוקי"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "שם יחידה לא חוקי"

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "הזז קובץ למטה"

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "הזז קובץ למעלה"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "סדר קבצים"

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "יש כבר יחידה בשם זה.%sקובץ: %s"

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "שם יחידה זה אינו שם חוקי של מזהה פסקל."

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "שם היחידה בשימוש כאשר ה IDE פורש את סעיף ה \"משתמש ב\" ."

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "שם יחידה:"

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "שם היחידה ושם הקובץ לא מתאימים. לדוגמה: unit1.pas ו  Unit1 "

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "הוספת CompiledSrcPath"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "תיקיית הפלט"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "סימון ספריית קוד המקור של החבילה"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "נתיב היחידה"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "אתה באמת רוצה לשכוח את כל השינויים לחבילה s% ולטעון אותה מחדש מהקובץ?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "יחידה חדשה שאינה נמצאת בנתיב היחידות"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "פרסם חבילה"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "לשחזר חבילה?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "הקובץ  %s%s%s%s אינו בנתיב החבילה כרגע. להוסיף אותו לנתיב החבילה?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "העזרה המקוונת עוד לא ממומשת"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "לחיצה ימנית על עץ הפריטים תקפיץ תפריט עם כל הפונקיות הזמינות של החבילה."

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "יש עוד פונקציות בתפריט הקופץ"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "בינארי"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "קובץ \"כלול\""

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "סוגיות של קובץ xml"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "טקסט של טופס לזארוס - LFM"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "משאבים של לזארוס - LRS"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "יחידה ראשית"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "טקסט"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "יחידה"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "יחידה ווירטואלית"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "הוספת תלות חדשה לחבילה s%:חבילה s%s%"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "הוספת תלות חדשה לפרוייקט s%:חבילה s%s%"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "הוסף יחידה לחלק ה uses של חבילה. בטל אפשרות זו רק עבור יחידות אשר לא אמורות להיות מהודרות בכל מקרה."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "נמצאו חבילות רב משמעיות"

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "חבילה שנדרשת לא נמצאה. ראה את גרף החבילות"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "חבילות שהותקנו אוטומטית"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "שתי החבילות קשורות. כלומר כל חבילה משתמשת בשניה, או ששתיהן משתמשות בחבילה שלישית."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "תלות שבורה"

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "מחזוריות בתלויות החבילות"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "מהדר חבילה  %s"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "המחיקה נכשלה"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "למחוק את הקובץ הישן של החבילה?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "מחק את קובץ החבילה הישן?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "תלויות ללא בעלים: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "שגיאה בקריאת קובץ"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "שגיאה בקריאת חבילה"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "שגיאה: עדכון קבצי po נכשל עבור חבילה %s"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "שגיאה בכתיבת קובץ"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "שגיאה בכתיבת חבילה"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "קובץ כבר בחבילה"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "קובץ נמצא בפרוייקט"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "שם הקובץ שונה משם החבילה"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "שם הקובץ בשימוש ע\"י חבילה אחרת"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "שם הקובץ נמצא בשימוש על ידי הפרויקט"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "הקובץ %s%s%s לא נמצא."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "הקובץ לא נשמר"

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "התעלם ושמור את החבילה עכשיו"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "התקנת החבילה s% תתקין אוטומטית את החבילה:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "התקנת החבילה s% תתקין אוטומטית את החבילות:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "שם קובץ לא חוקי של המהדר"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "סיומת הקובץ לא חוקית"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "סיומת קובץ החבילה אינו תקין"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "שם קובץ לא חוקי של החבילה "

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "שם החבילה אינו תקין"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "שם החבילה לא חוקי"

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "לזארוס"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "טעינת חבילה s% תחליף את החבילה s%s%s מקובץ %. החבילה הישנה שונתה. האם לשמור אותה?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "חבילה חדשה"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "חבילה: %s"

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "החבילה %s%s%s שונתה. האם לשמור?"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "התנגשויות בחבילה"

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "קובץ החבילה חסר"

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "קובץ החבילה לא שמור"

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "לחבילה %s%s%s אין תיקיית פלט חוקית: %s%s%s%s"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "החבילה לא מכילה חבילה לזמן עיצוב"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "נדרשת חבילה"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "קובץ קוד המקור הראשי של החבילה"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "שם החבילה כבר קיים"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "חבילה חייבת להיות עם הסיומת .lpk"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "יש לשמור קודם את הקובץ לפני הוספתו לחבילה"

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "יש לשמור קודם את החבילה."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "פרויקט: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "לבנות מחדש את לזרוס?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "לשנות שם הקובץ בחבילה?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "לשנות שם קובץ לאותיות קטנות?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "להחליף קובץ קיים %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "החלף קובץ"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "לשמור חבילה?"

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "לשמור חבילה?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "שמור חבילה  (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "האם צריך לשנות את שם הקובץ לאותיות קטנות ל %s%s%s%s ?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "דלג על חבילה זאת"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "קובץ הגדרות לחבילות סטטיות"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "קובץ המהדר לחבילה s% אינו קובץ ריצה חוקי: s%s%"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "הקובץ s%s%s% כבר נמצא בחבילה s%."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "הקובץ %s%s%s אינו חבילה של לזארוס"

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "שם הקובץ %s%s%s אינו מתאים לשם החבילה %s%s%s בקובץ. לשנות את שם החבילה ל %s%s%s?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "שם הקובץ %s%s%s הוא חלק מהםרוייקט. פרוייקט וחבילה לא יכולים לחלוק בקבצים."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "שם הקובץ %s%s%s בשימוש ע\"י חבילה %s%s%s בקובץ %s%s%s."

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "הקובץ %s%s%s%s השייך לחבילה s% חסר."

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "קודם צריך לשמור את הקובץ %s%s%s%s השייך לחבילה s% ."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "החבילה הבאה לא הצליחה להטען:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "החבילות הבאות לא הצליחו להטען:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "היחידות הבאות יתוספו לסעיף \"משתמש ב\" של %s%s:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "הידור החבילה %s%s%s לא הצליח.להסיר אותה מרשימת ההתקנות?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי של חבילת לזארוס."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "החבילה %s היא חבילת זמן ריצה בלבד. אי אפשר להתקין חבילה כזאת ב IDE."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "החבילה %s%s%s מסומנת להתקנה, אבל אי אפשר למצוא אותה.להסיר את התלות מרשימת ההתקנות של החבילות?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "החבילה s% דרושה ע\"י s%, אשר מסומנת להתקנה. ראה גרף החבילה."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "שם החבילה %s%s%s ב %s%s%s%s אינו שם חוקי, בחר שם אחר (למשל package1.lpk)."

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "שם החבילה %s%s%s של הקובץ %s%s%s%s אינו  חוקי."

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "החבילה s% היא בעלת הקובץ %s%s%s%s. האם לשנות גם את שם החבילה?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "החבילה %s%s%s סומנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "החבילה %s%s%s סומנה להתקנה. כרגע לזארוס תומך רק בחבילות מקושרות סטטית. הסרת ההתקנה הממשית דורשת בניה מחדש ואיתחול של לזארוס. האם אתה רוצה לבנות את לזארוס מחדש כעת?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "הפרוייקט דורש את החבילה s%s%s%, אבל אי אפשר למצוא אותה. ראה Project -> Project Inspector."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "יש שתי יחידות עם אותן השם: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s."

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "יש מעגליות בחבילות הדרושות.ראה גרף החבילות."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "יש יחידה של FPC עם אותו שם כמו של החבילה:%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "יש יחידה של FPC עם אותו שם כמו:%s%s%s%s%s%s מ %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "יש כבר חבילה אחרת עם השם %s%s%s. מתנגש עם חבילה: %s%s%s%s קובץ %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "ש כבר חבילה s%s%s% אשר נטענה מקובץ %s%s%s. ראה  Components -> Package Graph. החלפה אפשרית."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "יש חבילה לא שמורה בין החבילות הדרושות. ראה גרף החבילות."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "יש יחידה עם אותן השם כמו חבילה: %s%s1. אחת מ %s%s2. ואחת מ %s%s%s."

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "זאת חבילה וירטואלית. אין לה קוד עדיין. ראשית שמור את החבילה."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "לא ניתן ליצור את הספרייה"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "לא ניתן ליצור את ספריית הפלט %s%s%s%sעבור החבילה %s."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "לא ניתן ליצור את ספריית הקוד %s%s%s%sעבור החבילה %s."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "לא ניתן ליצור את ספריית היעד עבור לזרוס:%s%s%s%s.%sספרייה זו נחוצה עבור השינויים שנעשו ללזרוס עם החבילות שהותקנו."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "לא ניתן למחוק את הקובץ %s%s%s."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "לא ניתן למחוק את הקובץ"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "לא ניתן למחוק את קובץ המצב הישן %s%s%s%sעבור החבילה %s."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "לא מצליח לטעון את החבילה."

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "לא ניתן לפתוח את החבילה %s%s%s.%sהחבילה סומנה להתקנה."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "לא ניתן לקרוא את מצב הקובץ %s%s%s%sשל החבילה %s.%sשגיאה: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "לא מצליח לכתוב את החבילה %s%s%s% לקובץ %s%s%s. שגיאה: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "לא מצליח לכתוב קובץ מצב %s%s%s% של חבילה %s. שגיאה: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "להסיר את החבילה?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "להסיר את החבילה s%?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "חבילה לא שמורה"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "משתמש ביחידה"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "אזהרה: הקובץ %s%s%s%s שייך לפרויקט הנוכחי."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "רישום חבילה"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "לא יכול לרשום את הרכיבים ללא יחידה"

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "כלים ופונקציות לפריסה, עיון ועריכה של קוד פסקל - CodeTools"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "מחלקת רכיבים %s%s%s כבר מוגדרת"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "שם קובץ: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "מחלקת רכיבים לא חוקית"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "שם יחידה לא חוקי: s%"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "הקובץ של החבילה לא נמצא"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "פרוצדורת הרישום ריקה"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "יחידת הרישום נקראה, אבל אף חבילה לא נרשמת."

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "שגיאת רישום"

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "רכיב העורך SynEdit בשימוש ע\"י לזארוס. http://sourceforge.net/projects/synedit/"

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "ספריית הרכיבים  FCL של FreePascal מספקת מחלקות בסיסיות לפסקל מונחה עצמים."

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "ספריית הרכיבים  LCL של FreePascal מכילה את כל הרכיבים הבסיסיים לעריכת טפסים."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "החבילה %s%s%s מותקנת, אבל לא נמצא קובץ חוקי לחבילה (lpk.). חבילה שבורה מדומה נוצרה. "

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "ספריית זמן ריצה RTL היא בסיס לכל תכניות Free Pascal."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "זאת היא חבילת ברירת המחדל. משמשת רק לרכיבים ללא חבילה. רכיבים אלו לא מעודכנים."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "חבילה זאת מותקנת, אבל קובץ lpk לא נמצא. כל רכיביה נוטרלו. תקן זאת."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "שם יחידה: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "יחידה לא נמצאה: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "היחידה %s%s%s הוסרה מהחבילה"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "הקובץ הזה איננו באף חבילה שנטענה."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "לא ניתן לקרוא את קובץ החבילה %s%s%s.%sשגיאה: %s"

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "יציאות"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "גלובלי"

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "רק קבצים קיימים"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "קישורי חבילה"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "הראה קישורים גלובליים"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "הראה קישורי משתמש"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "משתמש"

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "אנא פתח יחידה לפני הרצה."

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "בחר קודם במצב בניה."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "אנא בחר את הקוד לחילוץ לפרוצדורה/מתודה חדשה."

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<הכל>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "שנה גופן"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "העתקת שם מתודה ללוח הזמני"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "סנן ע\"י התאמת חלק כלשהוא של המתודה"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "סנן ע\"י התאמת התחלת המתודה"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "קפוץ אל הקטע שנבחר"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<ללא>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "אוב&ייקטים"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "רשימת פרוצדורות"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "סוג"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "בחר תיקייה לקובץ po."

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "אל תשמור שום מידע session"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "מצביע"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "שמור בתיקיית ההגדרות של ה IDE"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "שמור בקובץ lpi."

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "שמור בקובץ lps. בתיקיית הפרוייקט"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "שמור מידע session ב"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "מלה קודמת"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "הספרייה הראשית בה לזרוס שומר את קבצי ההגדורת שלו. ברירת המחדל היא "

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "הדפס"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "פרטי"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "מתודה פרטית"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "כנראה שאתה צריך להתקין כמה חבילות לפני שתמשיך. אזהרה:s% הפרוייקט תלוי בכמה חבילות, המכילות יחידות עם פרוצדורות רישום. פרוצדורת רישום משמשת בדרך כלל להתקנת רכיבים ב IDE. אבל היחידות הבאות שייכות שייכות לחבילות שעדיין לא מותקנות ב IDE. אם תנסה לפתוח טופס ב IDE, אשר משתמש ברכיבים כאלו, תקבל שגיאה על רכבים חסרים וטעינת הטופס תיתן כנראה תוצאות לא נעימות. אין לזה השפעה על פתיחת הפרוייקט או איזה שהוא קובץ קוד שלו.זה רק אומר ש: זה רעיון גרוע לפתוח טופס לצורך עיצוב, לפני התקנת חבילות חסרות."

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "פרוצדורה"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "פרוצדורות עם ממשקים"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "תוכנה"

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "התוכנה %s היא תוכנת freepascal. קוד התוכנה מנוהל בצורה אוטומטית על ידי לזרוס."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "תוכנית התגלתה"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "קובץ קוד המקור של תוכנה חייב להכיל סיומות כדוגמת .pas, .pp או .lpr"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr "הוסף קבצים לפרוייקט"

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "הוסף קובץ לפרויקט: "

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "התלות כבר קיימת"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "הוסף קבצי עורך"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "הוסף קבצים"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "גירסה מינימלית-מקסימלית לא חוקית"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "שם חבילה לא חוקי"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "שם לא חוקי של יחידת פסקל "

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "גירסה לא חוקית"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "גירסה מקסימלית (לא חובה):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "גגירסה מינימלית (לא חובה):"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "דרישה חדשה"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "שם החבילה:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "החבילה לא נמצאה"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "התלות %s%s%s לא נמצאה. בחר חבילה קיימת."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "הגרסה המרבית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "הגרסה המקסימאלית נמוכה מהגרסה המינימאלית."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "הגרסה המינימלית s%s%s% שגויה. השתמש בצורה build.major.release לדוגמה: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "שם החבילה %s%s%s לא חוקי. בחר חבילה קיימת."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "לפרוייקט כבר יש תלות בחבילה %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "שם היחידה  %s%s%s כבר קיים בפרוייקט עם קובץ:  %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "שם היחידה  %s%s%s כבר קיים בבחירה עם קובץ:  %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "שם היחידה  %s%s%s אינו מזהה חוקי של פסקל."

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "הוסף לפרויקט"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "שם היחידה  כבר קיים"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "הפרויקט השתנה"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "הפרוייקט השתנה על הדיסק"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "תיקיית הפרויקט"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "הכותרת בשורת המשימות מראה גם את הנתיב אל תיקיית הפרוייקט"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "שם הקובץ של הפרויקט"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "פרוייקט כולל נתיב"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "התגלה קובץ המידע של הפרויקט"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "מידע הפרויקט"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "הפרויקט בר ריצה"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "מאקרו תכונות הפרויקט"

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "מאקרו ProjectUnitPath"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "תיקיית הפלט של הפרוייקט (למשל תיקיית ה ppu)"

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "נתיב הפרוייקט:"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "התיקייה שבה חייב להיות הקובץ הראשי של הפרוייקט"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "הפרוייקט העלה חריגה במחלקה s%"

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "הפרוייקט העלה חריגה במחלקה s% עם הודעה: s%s%"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "נתיב קוד המקור של הפרויקט"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "הפרויקט %s%s%s נבנה בהצלחה"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "יחידת הפרוייקט"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "נתיב יחידות הפרויקט"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "אשף הפרויקטים"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "אשר מחיקת תלויות"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "אשר הסרת קובץ"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "למחוק תלות ב s%?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "מפקח הפרוייקט s%"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "חבילות דרושות שהוסרו"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "להסיר קובץ S% מהפרוייקט"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "לא ניתן לקרוא את קובץ המצב %s של הפרויקט %s%sשגיאה: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "לא יכול לכתוב את קובץ המצב של הפרוייקט s%s% שגיאה: s%"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "תמיד בנה (גם אם לא היה שינוי)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "שגיאה"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "לא ניתן לשנות את רשימת הטפסים הנוצרים אוטומטית בקוד התוכנה.%sאנא תקן קודם את השגיאות."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "סימן תיקיית קוד המקור של הפרויקט"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "שאל על ערך"

#: lazarusidestrconsts.lisproperties
#, fuzzy
#| msgid "Properties (replace or delete)"
msgid "Properties (replace or remove)"
msgstr "תכונות (החלף או מחק)"

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "תכונות של אפשרות מהדר מותנה"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "מוגן"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "מתודה מוגנת"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "מתודה ציבורית"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "מתודה מסוג Published"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "פרסם את ספריית הפרויקט"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "מסנן \"אל תכלול\" לא חוקי"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "מסנן \"כלול\" לא חוקי"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "שמור את קובץ lrs. בתיקיית הפלט"

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "יחידה בפסקל חייבת להיות עם סיומת pp. או pas."

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "ערוך יחידה וירטואלית"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "יש כבר יחידה בשם זה.%sקובץ: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "שם יחידה זה אינו שם חוקי של מזהה פסקל."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "שם היחידה בשימוש כאשר ה IDE פורש את סעיף ה \"משתמש ב\" ."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "שם היחידה ושם הקובץ לא מתאימים. לדוגמה: unit1.pas ו  Unit1 "

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "המר פרוייקט דלפי"

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "פרויקט חדש"

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "פתח פרויקט"

#: lazarusidestrconsts.lispwopenrecentproject
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "פתח פרוייקט אחרון"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "צור משתנה מקומי"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "תיקונים מהירים"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "תיקון מהיר: הסר את היחידה"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "חפש מזהה"

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "צא מלזרוס"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "שגיאת קריאה"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "רשומה/מבנה נתונים"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "אוגרים"

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "שם"

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "ערך"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "ביטוי רגולרי"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "נתיב יחסי"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "הסר"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "הסר את כל התכונות הלא חוקיות"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "הסר את כל היחידות"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "הסר מרשימת ההתקנות"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "הסר מהפרוייקט"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "הסר מנתיב החיפוש"

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "הסר משתנה מקומי s%"

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "הסר משתנה מקומי"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr "הסר קבצים לא קיימים"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "הסר את היחידות שנבחרו"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "הסר אותם"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "הסר את הנתיבים מ \"Other sources\""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "הסר יחידה מסעיף \"משתמש ב\""

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "לשנות שם קובץ?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "שינוי שם הקובץ נכשל"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "שנה שם ל %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "שנה שם לאותיות קטנות"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "פתח פרוייקט מחדש"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "פתח מחדש בקידוד אחר"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "חזור על הספירה:"

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "החלפה"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "פונקציות חלופיות"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "תחליפים"

#: lazarusidestrconsts.lisreplaceremoveunknown
#| msgid "Replace unknown types and properties"
msgid "Fix unknown properties and types"
msgstr "תקן תכונות וסוגים לא מוכרים"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "החלפת הבחירה נכשלה."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "דורש FPC 2.4 ומעלה. כמו משאבי דלפי"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "סרוק מחדש"

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "שגיאה בטעינת משאב"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "שגיאה בשמירת משאב"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr "סוג משאב של הפרוייקט"

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "תגובה: להמשיך?"

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "תוצאה:="

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "תוצאה:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "מחזיר רשימה של כל הערכים של משתנה case לפני המשתנה"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "השחזור נכשל"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "ימין"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "עיגון לימין"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "רווח גבול ימני. ערך זה מתווסף לרווח הבסיסי ומשמש לרווח מימין לפקד."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "זהו פקד האח איליו מעוגן הצד הימני. השאר ריק עבור הורה."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "צדדים ימניים"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "רווח מימין במידה שווה"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Root"

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "(רץ ...) %s"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "הקובץ אינו קובץ ריצה"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "היישום המארח %s%s%s אינו קובץ ריצה"

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "\"הרץ עד ל\" נכשל"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "מתודה מופשטת - עדיין לא נדרסה"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "מתודה מופשטת של s%"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "הסמן אינו בהצהרת המחלקה"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "סביבת הפיתוח עסוקה"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "זוהי מחלקה מופשטת, יש לה מתודה מופשטת."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "לא נמצאה מתודה מופשטת"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "שכתב את כל מה שנבחר"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "שכתב את מה שנבחר ראשון"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "בחר בכלום"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "יש מתודות מופשטות לשכתוב. בחר את המתודות שעבורן צריך ליצור שארית:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "לא נשארו מתודות מופשטות לשכתוב."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "אי אפשר לעדכן את המתודה כי היא מוגדרת במחלקה הנוכחית"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "לא ניתן להציג את מתודות מופשטות של המחלקה הנוכחית, בגלל"

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "שמור ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "שמור את כל ההודעות לקובץ"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "שמור את כל הקבצים ששונו"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "שמור וצא מהדיאלוג"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "שמור ובנה מחדש את ה IDE"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "לשמור שינויים?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "לשמור שינויים לפרויקט %s?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "שמור את הקובץ הנוכחי שבעורך"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "שמור מידע עורך על קבצים שאינם של הפרוייקט"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "שמור קובץ כ"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "לשמור את הקובץ %s%s%s%s לפני סגירת הטופס %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "שמור מידע של קבצי עורך סגורים"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "שמור את פרוייקט %s "

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "שמור הגדרות"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "שמור"

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "קנה מידה:"

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "חפש את"

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "חפש יחידה"

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "תיקיית הגדרות משנית, המיקום בו לזרוס יחפש את תבנית קבצי ההגדרות . ברירת המחדל היא "

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "ראה הודעות."

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "ראה Project -> Project Inspector"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "בחר פריט עזרה"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "בחר צומת"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "בחר טפסים של דלפי (dfm.*)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "נבחר"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(שכן תחתון שנבחר)"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(שכן שמאלי שנבחר)"

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(שכן ימני שנבחר)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(שכן עליון שנבחר)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "בחר את הקובץ"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "הבחירה חורגת מגבולות המחרוזת"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "כלי בחירה"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "בחר את אופן הבניה הפעיל"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "קבע ברירת מחדל"

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr "קבע ערכי מאקרו"

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(קבע זיהוי ברירת מחדל)"

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "קבע ערך"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "קצר:"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "הראה"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "הראה טיפים של הצהרה"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "הראה הבדלים בין האופנים..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "הראה יחידות/חבילות ריקות"

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "הראה גליף עבור:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "הראה gutter"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "הראה רמזים"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "הראה מזהים"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "הראה תיבת מידע"

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "הראה סדר לשוניות ישן"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "הראה חבילות"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "הראה תווים מיוחדים"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "הראה שורת מצב"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "הראה יחידות"

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
#, fuzzy
msgid "Show value hints while debugging"
msgstr "הראה טיפים חשובים בזמן ניפוי השגיאות"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "הראה גירסה וצא"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "כווץ לקטן ביותר"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "אח"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "תחביר פשוט"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "דלג על הקובץ"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "דלג על הקובץ והמשך בטעינה"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "דלג על טעינת הפרויקט האחרון"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "קטן עדיף על מהיר"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "התאמות"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "מצטער, לא ממומש עדיין"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "מצטער, סוג זה לא ממומש עדיין"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "עולה"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "בטל"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "תלוי ברישיות&"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "יורד"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "מתחם"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "התעלם מרווח"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "שורות"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "אפשרויות"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "פיסקאות"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "תצוגה מקדימה"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "קבל"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "סדר את הבחירה"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "מילים"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "המקור והיעד זהים: %s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "נקודת עצירה בקוד"

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "תיקיית המקור %s%s%s% ותיקיית היעד %s%s%s% זהות. יתכן שלא הבנת תכונה זאת. היא תנקה/תיצור מחדש את תיקיית היעד ותעתיק אליה את החבילה/פרוייקט."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "תיקיית המקור %s%s%s לא קיימת"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "המקור השתנה"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "המקור של דף השתנה %s%s%s. לשמור?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr "המקורות של יותר מעמוד אחד השתנו. לשמור עמוד %s%s%s ? (יותר %d)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "נתיב למקור"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "רווח במידה שווה"

#: lazarusidestrconsts.lissrcos
#, fuzzy
msgid "Src OS"
msgstr "מערכת הפעלה של הקוד"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "מחפש"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "חפש טקסט"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "התחל בהמרה"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "התחל עם פרוייקט חדש"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "להפסיק את ניפוי השגיאות הנוכחי ולבנות מחדש?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "להפסיק את ניפוי השגיאות?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "להפסיק את ניפוי השגיאות?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "עצור אם יש חריגה"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "להפסיק את ניפוי השגיאות?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "קובץ lpi מוזר"

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "שגיאת זרימה"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "שגיאת זרימה"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "מחרוזת"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "סגנון"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "תת שגרה"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "תת שגרה באותה רמה"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "הצלחה"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "נתיב \"כלול\" חשוד"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "נתיב יחידה חשוד"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN Revision: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "שם משתנה לא חוקי"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr " לא מזהה חוקי %s%s%s"

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "עדכן את משתני המערכת"

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "מצב תחביר"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "לשונית"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "סדר לשוניות של "

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "מעבד היעד"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
#| msgid "Target file name: (empty = use unit output directory)"
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "שם קובץ המטרה: (ריק = השתמש בתיקיית הפלט של היחידה)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "שם קובץ היעד (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "קובץ המטרה של הפרוייקט"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "שם קובץ המטרה והפרמטרים שלו"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "מערכת ההפעלה המיועדת"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "שגיאת מהדר פנימית! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "תא בר עריכה"

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr "מכניס תא בר עריכה, עם ערך ברירת מחדל, (Sync=n (,S=n, לסינכרון עם התא הקודם מ n=1 ועד לתא הקודם הגבוה ביותר. ברירת המחדל היא לסנכרן עם התא הקודם עם אותה ברירת מחדל "

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "תיקיית ביקורת"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "חבילת היישומים נוצרה עבור \"%s\""

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr "מאקרו הבנייה  \"%s\" לא מתחיל ב \"%s\"."

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "המחלקה  %s%s%s היא TControl ואי אפשר להדביק אותה על מחלקה שאינה פקד. לא יכול להדביק."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "נמצאה שגיאה: %s%s%s ע\"י CodeTools"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "הפקודה אחרי %s%s%s אינה ברת ביצוע"

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "הפקודה אחרי הפירסום אינה חוקית: %s%s%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "לא ניתן למחוק את הרכיב, כי הוא שייך ל s%."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "עורך הרכיבים של מחלקה %s%s%s  גרם לשגיאה: %s%s%s%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "עורך הרכיבים של מחלקה %s%s%s  שהופעל ע\"י פעולה #%s %s%s%s%s גרם לשגיאה: %s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "הרכיב s% הוא ירושה מ s%. כדי למחוק רכיב מורש  פתח את האב ומחק אותו שם."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "הרכיב s% הוא ירושה מ s%. כדי לשנות שם רכיב מורש  פתח את האב ומחק אותו שם."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr "שם הרכיב חייב להיות יחודי בין כל הרכיבים של הטופס/מודול הנתונים.השם מושווה ללא רגישות לראשיות כמו כל מזהה פסקל נורמלי."

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "השם הנוכחי של המהדר %s%s%s%s אינו קובץ ריצה חוקי. בחר  OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק  Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "השם הנוכחי של המהדר %s%s%s%s אינו קובץ ריצה חוקי.  בדוק  Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "תיקיית הקוד הנוכחית של Free Pascal אינה נראית תקינה. בחר  OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק  Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "תיקיית הקוד הנוכחית של Free Pascal אינה נראית תקינה.  בדוק  Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "תיקיית לזארוס הנוכחית אינה נראית תקינה. בלעדיה לא תוכל ליצור יישומי LCL. בחר  OK כדי לבחור את ברירת המחדל %s%s%s. אחרת בדוק  Environment ->Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "תיקיית לזארוס הנוכחית אינה נראית תקינה. בלעדיה לא תוכל ליצור יישומי LCL. בדוק  Environment ->Environment Options -> Files"

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "הנתיב הנוכחי של היחידה עבור הקובץ %s%s%s%s היא %s%s%s%s. הנתיב ליחידות LCL חסר.טיפ לטירונים: צור יישום לזארוס ושים את הקובץ בתיקיית הפרוייקט."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "מנפה השגיאות אינו קיים או שאינו קובץ ריצה. ראה Environment -> Debugger Options"

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "תיקיית היעד %s%s%s%s אינה קיימת. "

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "תיקיית היעד %s%s%s%s אינה קיימת. בדוק את שם קובץ המטרה של הפרוייקט Menu > Project > Project Options."

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "התיקייה %s%s%s%s אינה דרושה עוד בנתיב היחידה. להסיר אותה?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "התיקייה %s%s%s%s אינה מורשה לכתיבה."

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "התיקייה %s%s%s%s עדיין אינה בנתיב היחידה. להוסיף אותה?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "התיקייה %s לא נמצאה. "

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr " הקובץ %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "הקובץ s% לא נראה כמו קובץ lpi."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "אינדקס הקובץ דרוש לפונקציות כמו \"מצא הצהרה\". בזמן הסריקה אתה יכול לערוך את הקוד ולהדרו, אבל פונקציות כאלו יתנו שגיאות \"יחידה לא נמצאה\". זה יכול לקחת דקה."

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "הקובץ %s%s%s הוא קישור סימבולי. לפתוח את %s%s%s במקומו?"

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "הקובץ %s%s%s אינו פרוייקט של דלפי (dpr.)"

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "הקובץ %s%s%s אינו יחידה של דלפי."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "הקובץ %s%s%s אינו פרוייקט של לזארוס. האם ליצור פרוייקט חדש בשבילו?"

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "הקובץ %s%s%s נראה כתוכנית. לסגור את הפרוייקט הנוכחי וליצור פרוייקט לזארוס חדש? No יגרום לטעינת הקובץ כקובץ קוד רגיל."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "הקובץ %s נראה כקובץ תוכנית של פרוייקט לזארוס קיים."

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "הקובץ %s%s%s%s נמצא באחת מתיקיות הקוד של החבילה ונראה כמו יחידה מהודרת. יחידות מהודרות חייבות להיות בתיקיית הפלט של החבילה, אחרת חבילות אחרות ייתקלו בבעיות בשימוש בחבילה זאת. האם למחוק את הקובץ הבעייתי?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "הקובץ %s%s%s%s לא נמצא. האם אתה רוצה למצוא אותו בעצמך?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "הקובץ %s%s%s%s לא נמצא. \"התעלם\" יגרום להמשך טעינת הפרוייקט, \"צא\" יעצור את הטעינה."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "אופן הבנייה הראשון הוא אופן ברירת המחדל וחייב להשמר בפרוייקט ולא ב session."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "אופן הבנייה הראשון הוא אופן ברירת המחדל וחייב להשמר בפרוייקט ולא ב session."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "המתודות הבאות שבשימוש s% אינם במקורות %s%s%s%s%s%s האם להסיר את המקורות הרעועים?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "המהדר של Free Pascal (שם קובץ\" s%) לא נמצא. מומלץ שתתקין fpc."

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "תיקיית הקוד של Free Pascal לא נמצאה. חלק מאפשרויות הקוד לא יעבדו. מומלץ שתתקין ותגדיר את הנתיב Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr "מנפה השגיאות של GNU דרך ssh מאפשר ניםוי מרחוק דרך חיבור ssh. לפרטים ראה docs/RemoteDebugging.txt. הנתיב חייב להכיל את שם לקוח ה ssh,שם המארח עם אפשרות לשם משתמש ושם קובץ ה gdb במחשב המרוחק. לדוגמה: usr/bin/ssh username@hostname gdb/או usr/bin/setsid /usr/bin/ssh username@hostname gdb/"

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "המזהה הוא יחידה. השתמש ב File - Save כאמצעי לשינוי שם היחידה."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "המקש %s% כבר מוקצה ל s%. להסיר את ההקצאה הישנה למקש עבור הפונקציה החדשה?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "חבורת היישומים s%s% הדרושה להרצה לא קיימת או שאינה ברת ריצה. האם אתה רוצה ליצור אחת? ראה Project -> Project Options -> Application for settings."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "היישום המשגר %s%s%s%s לא קיים או שאינו בר ריצה. ראה Run -> Run parameters -> Local"

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "תיקיית לזארוס לא נמצאה.לא תוכל ליצור יישומי LCL. בדוק Environment -> Environment Options -> Files"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "קובץ ה LFM (טופס לזארוס) מכיל תכונות לא חוקיות. כלומר הוא מכיל למשל כמה תכונות/מחלקות, אשר לא קיימות ב LCL הנוכחי. התיקון הרגיל הוא להסיר תכונות אלו מקובץ ה lfm ולתקן ידנית את קוד הפסקל."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "השם %s%s%s אינו שם חוקי למזהה פסקל."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "קובץ \"כלול\" החדש עדיין לא בנתיב החיפוש. האם להוסיף את התיקייה %s ?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "היחידה החדשה עדיין אינה בנתיב חיפוש היחידות. להוסיף תיקייה?"

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "ה \"Other sources\" מכיל תיקייה שכבר נמצאת ב \"Other unit files\"."

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "תיקיית הפלט %s%s%s חסרה."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של קבצי ה\"כלול\"."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש המורשים של קבצי ה\"כלול\"."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות המורשות."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "תיקיית הפלט של s% היא ברשימת נתיבי החיפוש של היחידות."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "תיקיית הפלט צריכה להיות תיקייה נפרדת שאינה מכילה קבצי קוד."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "למחלקה שהיא הבעלים יש את השם הזה"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "לבעלים יש את השם הזה"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "החבילה %s מוסיפה את הנתיב \"%s\" לנתיב \"כלול\" של ה  IDE. זוהי כנראה הגדרה שגוייה של החבילה."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "החבילה %s מוסיפה את הנתיב \"%s\" לנתיב היחידה של ה  IDE. זוהי כנראה הגדרה שגוייה של החבילה."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "החבילה כבר מכילה יחידה עם שם זה."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "אי אפשר להסיר את התקנת החבילה, כי היא דרושה ל IDE עצמו."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "לחבילה %s אין אף פרוצדורת רישום, שבדרך כלל אומר שהיא לא מספקת שום תוסף ל IDE. התקנתה רק תגדיל את גודל ה IDE ויכולה אפילו לגרום לחוסר יציבות.טיפ: אם אתה רוצה להשתמש בחבילה בפרוייקט שלך, השתמש בתפריט \"Add to project\"."

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "התוכנית make לא נמצאה. כלי זה דרוש לבניית לזארוס."

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "אפשרויות המהדר לפרוייקט, וההוראות בקובץ הקוד הראשי שונות. עבור היחידה החדשה משתמש באפשרויות האופן וסוג המחרוזות של הפרוייקט."

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr "הפרוייקט לא משתמש ביחידות ממשקים של LCL, אבל נראה שהיא זקוקה להן. תקבל שגיאות מקשר מוזרות אם תשתמש בטפסי LCL ללא ממשקים."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "לפרוייקט אין קובץ קוד ראשי"

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "קובץ מידע הפרוייקט %s%s%s%s זהה לקובץ הקוד הראשי של הפרוייקט!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "קובץ מידע הפרוייקט %s%s%s%s השתנה על הדיסק."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "הפרוייקט חייב להשמר לפני הבנייה. אם תקבע את תיקיית הביקורת באפשרויות הסביבה, תוכל ליצור פרוייקטים חדשים ולבנות אותם מיד. לשמור את הפרוייקט?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "הפרוייקט משתמש כמטרה במערכת ההפעלה = s% ובמעבד = s%. הקובץ system.ppu עבור מטרה זאת לא נמצא בתיקיית הקבצים הבינאריים של FPC.ודא ש fpc מותקו כראוי עבור מטרה זאת ושהקובץ fpc.cfg מכיל את התיקיות הנכונות."

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "הפרוייקט משתמש במשאבי FPC חדשים, אשר דורשים לפחות FPC 2.4"

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "יש קבצים נוספים בתיקייה בעלי אותו שם, אשר נבדלים רק בראשיות: האם למחוק אותם?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "יש קובץ בעל אותו שם וסיומת דומה בדיסק קובץ: %s%s קובץ רב משמעי:  %s%s%s , האם למחוק את הבעייתי?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr "יש כבר מאקרו בנייה עם השם %s%s%s ."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "יש כבר רכיב עם שם זה. "

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "יש כבר טופס עם השם %s%s%s. "

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "יש כבר מאקרו של  IDE בשם  \"%s\""

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "יש כבר יחידה עם השם %s%s%s. מזהה פסקל חייב להיות ייחודי."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "יש כבר יחידה עם השם %s%s%s בפרוייקט. בחר שם אחר."

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "חייב להיות לפחות אופן בנייה אחד."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "מחלקת המשאבים %s%s%s עברה בירושה מ s%s%s%. כנראה זאת שגיאת דפוס של TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "הייתה שגיאה בזמן כתיבת הרכיב שנבחר %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "הייתה שגיאה בזמן המרת הזרימה הבינארית של הרכיב שנבחר %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "הייתה שגיאה בזמן העתקת זרימת הרכיב שנבחר ללוח הזמני:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "אי אפשר למחוק את רכיב השורש."

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "ההגדרות אוחסנו עם הפרוייקט."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "היחידות לא נמצאו:"

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "לא ניתן למצוא את תיקיית הביקורת: %s%s%s%s%s (ראה אפשרויות סביבה)"

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "היחידה %s%s%s כבר קיימת. \"התעלם\" יאלץ שינוי שם, \"בטל\" יבטל את השמירה של קוד זה ו \"צא\" יגרום לביטול של כל השמירה."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "היחידה שייכת לחבילה s%"

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "היחידה s% קיימת פעמיים בנתיב היחידות של: s%"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "ליחידה יש את השם הבא"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "שם קובץ היחידה %s%s%s אינו באותיות קטנות. המהדר של FreePascal לא מחפש את כל אפשרויות הראשיות. מומלץ להשתמש באותיות קטנות בשם הקובץ.לשנות את השם לאותיות קטנות."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "קובץ אחר משתמש ביחידה s%. לעדכן את המקורות אוטומטית?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "ליחידה עצמה יש כבר את השם %s%s%s. מזהה פסקל חייב להיות ייחודי."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "נתיב חיפוש היחידות של %s%s%s מכיל את תיקיית הקוד %s%s%s של חבילה s%"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "תיקיית העבודה %s%s%s לא קיימת. בדוק את תיקיית העבודה ב Menu > Run > Run parameters."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "הפונקציה צריכה קובץ lfm. פתוח בעורך הטקסט."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "הודעת עזרה ז"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "זה נראה כמו קובץ פסקל. מומלץ להשתמש בשם באותיות קטנות, כדי למנוע בעיות שונות במערכות הפעלה מסוימות ובמהדרים אחרים. לשנות את השם לאותיות קטנות?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "לפרוייקט זה אין קובץ קוד ראשי"

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "סט זה של אפשרויות הבניה של לזארוס לא נתמך ע\"י התקנה זאת. לא ניתן לכתוב לתיקייה %s%s%s. ראה באתר לזארוס על דרכים אחרות להתקין את לזארוס."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "אי אפשר לחלץ משפט זה. בחר קוד אחר לחילוץ פרוצדורה/מתודה חדשה."

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr "זה ייצור מעגל."

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "סגור אוטומטית אם הפעולה הצליחה"

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "מהדר את:"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "כותרת&"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "הכותרת בסרגל המשימות מראה למשל: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "כותרת (השאר ריק לברירת מחדל)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "פונקציה: הוסף את תוחם הנתיב"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "פונקציה: חתוך את תוחם הנתיב"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "פונקציה: חלץ את סיומת הקובץ"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "פונקציה: חלץ את שם וסיומת הקובץ"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "פונקציה: חלץ את שם הקובץ בלבד"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "פונקציה: חלץ את נתיב הקובץ"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(מאקרו לא מוכר: s%)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "נתיב:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "החלף בין תצוגה עם נתיב מלא לבין נתיב יחסי"

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr "כדי להתקין אתה חייב להדר ולאתחל את ה  IDE"

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "פסגה"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "עיגון למעלה"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "גבול עליון. ערך זה יתווסף לרווח הבסיסי וישמש לרווח מעל הפקד."

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "עליונים"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "זהו פקד האח שאליו מעוגן הצד העליון. השאר ריק עבור הורה."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "רווח שווה מלמעלה"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "העת זקוק לרענון"

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "טורבו פסקל"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "סוגים( לא הוסרו אם אין תחליף)"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "אל תראה הודעה זאת שוב."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "שגיאה בביטוי רגולרי"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "גופן ללא UTF-8"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "לך לשורה:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "לא נמצא"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "להחליף מופע זה של %s%s%s%s ב %s%s%s?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "מחפש את: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "חיפוש המחרוזת '%s' לא נמצא!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "הגופן הנוכחי של העורך לא תומך ב UTF-8, אבל נראה שהמערכת שלך משתמשת בו. זה אומר שתווי ASCII כנראה יוצגו לא נכון. אתה יכול לבחור גופן אחר באפשרויות העורך."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "נקה את מטמון הinclude"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "בתים %s"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "נקה"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "נכלל ע\"י:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "בפרויקט:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "שורות:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "שם:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "לא"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "אשר"

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "נתיבים (קריאה בלבד)"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "גודל:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "קוד מקור"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "סוג:"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "יחידה"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "כן"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "הראה את ערכי CodeTools"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "לא ניתן להמיר זרם של מידע בינרי לטקסט"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "לא ניתן להעתיק רכיב ללוח הזמני"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "לא ניתן להוסיף הערות בראש קובץ המשאבים %s%s%s%s.%s כנראה שגיאת תחביר"

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "לא ניתן להוסיף את המשאב T%s:FORMDATA לקובץ המשאבים %s%s%s%s.%s כנראה בגלל שגיאת תחביר"

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "לא יכול להוסיף הגדרה"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "לא ניתן להוסיף את %s לפרויקט בגלל שיש כבר יחידה עם שם זהה בפרויקט."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "פעולת הגיבוי של הקובץ %s%s%s לקובץ %s%s%s לא הצליחה!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "לא יכול לשנות את המחלקה s% ל s%"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "לא ניתן לנקות את ספריית היעד"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "לא ניתן לנקות את %s%s%s.%s יש לבדוק הרשאות."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "לא ניתן להמיר את הטקסט ברכיבים למבנה בינארי:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "לא ניתן להמיר את הקובץ %s%s%s%sשגיאה: %s"

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "לא ניתן להמיר ולשמור את קובץ ה lfm לקובץ lrs."

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "לא ניתן להמיר מידע טקסטואלי של הקובץ %s%s%s%s%s לזרם בינרי. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "לא ניתן להעתיק את הקובץ"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "לא ניתן להעתיק את הקובץ %s%s%s%sל%s%s%s"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "לא ניתן להעתיק את הקובץ %s%s%s%sל %s%s%s."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "לא ניתן ליצור את תיקיית הגיבוי %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "לא ניתן ליצור את התיקייה %s%s%s."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "לא ניתן ליצור את התיקייה %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "לא ניתן ליצור את הקובץ"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "לא ניתן ליצור את הקובץ %s%s%s"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "לא יכול ליצור את הקובץ %s%s%s%s"

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "לא ניתן ליצור את הקובץ %s%s%s."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "לא ניתן ליצור את הקישור %s%s%s עם %s%s%s"

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "לא ניתן ליצור מתודה חדשה. יש לתקן את השגיאה שמוצגת בחלון ההודעות."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "לא ניתן ליצור חוצץ זמני לlfm."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "לא יכול למחוק"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "לא ניתן למחוק את הקובץ הרב משמעי %s%s%s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "לא יכול למצוא את סעיף המשאבים ביחידה זאת או כל יחידה אחרת שבשימוש."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "לא ניתן למצוא שם תקני למחלקה ב%s%s%s"

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "לא ניתן למצוא את הקובץ %s%s%s."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "לא ניתן למצוא את הקובץ s%s%s.%s אם הקובץ שייך לפרויקט, יש לבדוק את נתיב החיפוש ב%s פרויקט->מהדר->אפשרויות...->נתיבי חיפוש->קבצי יחידות אחרים. אם קובץ זה שייך לחבילה, יש לבדוק את אפשרויות המהדר בחבילה. אם הקובץ שייך ללזרוס, יש לנקות את הקבצים המהודרים. במידה והקובץ שייך ל FPC, אז יש לבדוק את ההגדרות ב fpc.cfg. במידה ואתה לא בטוח, בדוק את פרוייקט->אפשרויות מהדר ...->בדיקה"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "לא ניתן למצוא את %s בזרם של LFM."

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "לא ניתן למצוא מתודה. יש לתקן את השגיאה המוצגת בחלון ההודעות."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "לא יכול למצוא יחידת פסקל (pas,.pp.) עבור קובץ lfm%s%s%s%s"

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "לא ניתן למצוא את היחידה שבה מוגדרת המחלקה של הרכיב %s%s%s."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "לא ניתן לקבל מידע על שינויים בעורך."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "לא ניתן לקבל את הקוד של המתכנן."

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "לא יכול לטעון קובץ: s%s%"

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "לא ניתן לטעון את קובץ המשאבים הישן. %s קובץ המשאבים הוא ה include הראשון בחלק ה%sinitialization.%s למשל {$I %s.lrs}.%sכנראה שמדובר בשגיאת תחביר."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "לא יכול לטעון חבילה %s%s%s"

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "לא ניתן לטעון את המחלקה %s%s%s ברכיב, בגלל שהיא תלויה בעצמה."

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "לא ניתן לפתוח את רכיב האב"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "לא ניתן לפתוח את המתכנן. %s המחלקה %s אינה יורשת ממחלקה אחרת כדוגמת TFrom או TDataModule."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "לא ניתן לקרוא את הקובץ %s"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "לא ניתן לקרוא את הקובץ"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "לא ניתן לקרוא את הקובץ %s%s%s!"

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "לא ניתן לקרוא את הקובץ %s%s%s%sשגיאה: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "לא ניתן לקרוא את הקובץ %s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "לא יכול לקרוא את קובץ מידע הפרוייקט %s%s%s%s."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "לא יכול לקרוא את קובץ מידע הפרוייקט %s%s%s%s."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "לא ניתן להסיר את קובץ הגיבויים  %s%s%s הישן!"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "לא ניתן לשנות את השם של קובץ רב משמעי %s%s%s%sל %s%s%s"

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "לא ניתן לשנות את שם הקובץ"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "לא ניתן לשנות את שם הקובץ %s%s%s ל %s%s%s!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "לא ניתן לשנות את שם הקובץ %s%s%s%sל %s%s%s."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "לא ניתן לשנות את שם הטופס בקוד המקור."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "לא ניתן לשנות את שם המתודה. תקן את השגיאה המופיעה בחלון ההודעות."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "לא ניתן לשנות את שם המשתנה בקוד המקור."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "לא ניתן להריץ"

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "לא ניתן לשמור את הקובץ %s%s%s"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "לא ניתן לקבוע את צד העיגון בפקד"

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "לא ניתן להציג מתודה. יש לתקן את השגיאה המוצגת בחלון ההודעות."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "לא ניתן להזרים את הרכיבים שנבחרו"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "לא ניתן להזרים את הרכיבים שנבחרו."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "לא ניתן לגרום להזרים את %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "לא ניתן להמיר את הזרם הבינרי של הרכיב %s:T%s לטקסט."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "לא ניתן לעדכן את CreateForm בקוד המקור של הפרויקט."

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "לא יכול לעדכן את קובץ המשאב הבינארי %s%s%s מקובץ הטקסט של המשאב %s%s%s%s כנראה קובץ הטקסט הרוס."

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "לא יכול לכתוב %s%s%s%s%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "לא יכול לכתוב %s%s%s"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "לא יכול לכתוב קובץ"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "לא יכול לכתוב קובץ %s%s%s%s שגיאה: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "לא יכול לכתוב את קובץ מידע הפרוייקט %s%s%s%s. שגיאה: s%"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "לא יכול לכתוב את קובץ ה  session . שגיאה: %s"

#: lazarusidestrconsts.lisunabletowritetofile
msgid "Unable to write to file %s%s%s."
msgstr "לא יכול לכתוב קובץ %s%s%s."

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "לא יכול לכתוב לקובץ \"%s\" ."

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "לא יכול לכתוב זרימת xml ל  %s%s שגיאה: %s"

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "תוצאה לא צפויה: %s מנפה השגיאות ייסגר"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "אי אפשר להסיר את ההתקנה"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "הסר את התקנת הבחירה"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "יחידה %s%s%s השתנתה. לשמור?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "מזהה היחידה קיים"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "יחידה s% בחבילה %s%s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "שם היחידה כבר קיים בפרוייקט"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "שם היחידה מתחיל ב ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "שם היחידה מכיל ..."

#: lazarusidestrconsts.lisunitnotfound
msgid "A unit not found in"
msgstr "לא נמצאה יחידה"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "תיקיית הפלט של היחידה"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "נתיב היחידה"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "נתיבי היחידה"

#: lazarusidestrconsts.lisunitsnotfound2
msgid "Units not found in"
msgstr "היחידה לא נמצאה ב"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "ללא סימן"

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "יחידות שאינן בשימוש"

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr "עדכן תצוגה מקדימה"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "עדכן מקורות"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "מחרוזת באותיות ראשיות"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "מחרוזת באותיות ראשיות ניתנה כפרמטר"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "הודעת \"איך להשתמש\" (אפשרות h-)"

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr "השתמש ב ..."

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr ""

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "השתמש במסנן \"אל תכלול\""

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "השתמש במזהה"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "השתמש במזהה s% ב %s ב %s"

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "השתמש במסנן \"כלול\""

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "יישום משגר"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "השתמש בחבילה %s בחבילה %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "השתמש בחבילה בחבילה"

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "השתמש בחבילה %s בפרוייקט"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "השתמש בחבילה בפרוייקט"

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "תיקיית הבית של המשתמש"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "השתמש ביחידה %s ביחידה %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 עם BOM"

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr "ערך:"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "ערך%s"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "ערכים"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "וודא קריאות למתודות"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "גרסה"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "אנכי"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "העתק את הגרסה ללוח הזמני"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr "הצג תכונות נקודת עצירה"

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "הצג יחידות הפרויקט"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "הצג קוד (.lfm)"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "חיפוש לפנים"

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "אתחל את רשימת התוצאות"

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "אזהרה: נמצא קובץ רב משמעי: %s%s%s. קוד המקור של הקובץ הוא: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "אזהרה: זאת היחידה הראשית, היחידה הראשית החדשה תהייה  s.pas%"

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "משגיח"

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "תכונות המשגיח"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "כששם היחידה משתנה, עדכן את המקורות"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "כאשר מופעל - האפשרויות הנוכחיות נשמרות בתבנית, אשר משתמשים בה ביצירת פרוייקט חדש"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "כאשר הסמן של עורך הקוד נע, הראה את הצומת הנוכחית בסייר הקוד"

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr "עם קבצי \"כלול\""

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr "עם קבצי \"כלול\""

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "עם החבילות הנידרשות"

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "הו&סף"

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "מ&חק"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "מח&ק הכל"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "ב&טל הכל"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "א&פשר הכל"

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "מאופשר"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "ביטוי"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "תכונות&"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "רשימת המשגיחים"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "המילה הנמצאת במיקום הסמן בעורך הנוכחי"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "תיקיית עבודה לבנייה"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "תיקיית עבודה לריצה"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "שגיאת כתיבה"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "שגיאת כתיבה: %s%sקובץ: %s%s%s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "שגיאת XML"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "קבצי XML"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "שגיאה בקובץ %s בעת קריאת XML%sשגיאה: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
#, fuzzy
#| msgid "You can disable this for individual forms via the popup menu in the source editor, file settings, i18n for lfm strings"
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "אתה יכול לנטרל זאת לטפסים מסוימים דרך התפריט הקופץ של עורך הקוד , הגדרות קובץ, i18n עבור מחרוזת lfm"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "לא ניתן לבנות את לזרוס בזמן שהוא מנפה שגיאות או מהדר"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "עורך קוד מקור"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "הוסף את יחידת החבילה לחלק ה \"משתמש ב\""

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "הוסף הפוך"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "הגדל אוטומטית את מספר הבנייה"

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "סורקים קיימים"

#: lazarusidestrconsts.rsbuild
#| msgid "Build:"
msgid "&Build:"
msgstr "בנה:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "סדרת תווים:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "סגור את הדף הנוכחי"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "הגדרות מותנות"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "צור הגדרה חדשה"

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "יצירת תיקייה \"%s\" נכשלה!"

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "צירת קישור סימבולי  \"%s\" נכשלה!"

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "צירת קישור סימבולי אינה נתמכת במערכת זאת!"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "אפשר i18n"

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "הכנס אחד או יותר ביטויים שאתה רוצה לחיפוש או למסנן שברשימה, מופרדים ע\"י רווח , או פסיק"

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "סנן את הרשימה עם הביטוי המסנן הנוכחי"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "קובץ מידע טופס (dfm.*)"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "נמצא אבל לא מופיע ברשימה שכאן:"

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "לך לפריט הבא ברשימת החיפוש"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "אפשרויות i18n"

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "כלול מידע גירסה בקובץ הריצה"

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "מיקום מותאם אישית"

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "ברירת מחדל"

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "מעוגן"

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "שחזר את נתוני החלון"

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "שחזר את גודל החלון"

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "השתמש בהגדרות מנהל החלונות"

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "מקש"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "אפריקנית"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "ערבית"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "אוטומטי (או אנגלית)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "קטלנית"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "סינית"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "צ'כית"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "הולנדית"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "אנגלית"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "פינית"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "צרפתית"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "גרמנית"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "עברית"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "אינדונזית"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "איטלקית"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "יפנית"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "לטבית"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "אפשרויות שפה"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "פולנית"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "פורטוגזית"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "רוסית"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "בחירת שפה:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "סלובקית"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "ספרדית"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "טורקית"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "אוקראינית"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "גירסה ראשית:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "גירסה משנית"

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr "אשר"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "מידע אחר"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "ספריית הפלט של קבצי PO"

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "הס&ר"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "אתחל מסנן"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "עידכון:"

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "סורקים"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "בחר ערך מורש"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "התחל חיפוש חדש"

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "ערך"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "מספור גרסאות"

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "המקש \"%s\" כבר מקושר ל \"%s\""

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "מקש אלטרנטיבי (או צירוף של 2 מקשים)"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "פקודות תפריט עזרה"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "פקודות פקודה"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "פקודות CodeTools"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "פקודות בחירת עמודת טקסט"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "פקודות של תזוזות עכבר"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "פקודות של עריכת טקסט"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "פקודות של תפריט \"סביבה\""

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "פקודות של תפריט \"קובץ\""

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "פקודות של קיפול טקסט"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "פקודות של סימון טקסט"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "פקודות של תפריט \"חבילה\""

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "פקודות של תפריט \"פרוייקט\""

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "פקודות של תפריט \"הרץ\""

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "פקודות של תפריט \"חפש והחלף\""

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "פקודות של בחירת טקסט"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "פקודות של פנקס הקוד"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "עריכה של כל המופעים "

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "עריכה של כל המופעים  (לא בתא)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "עריכה של כל המופעים  (בזמן בחירה)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "עריכת תבנית"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "עריכת תבנית (לא בתא)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "פקודות של תפריט \"כלים\""

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "פקודות של תפריט \"הצג\""

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "פקודה:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr "    פקודה1 \""

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr "    פקודה2 \""

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "התנגשות"

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr "מתנגש עם"

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "בטל בנייה"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "הוסף נקודת קפיצה"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "הוסף משגיח"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "השלמת תבנית קוד"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "העתק בלוק"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "מחק בלוק"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "לך להתחלת בלוק"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "לך לסוף בלוק"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "הסתר בלוק"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "הזכך בלוק"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "הזז בלוק"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "קבע התחלת בלוק"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "קבע סוף בלוק"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "הראה בלוק"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "החלף בלוק"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "בטל זיהוי בלוק"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "בנה תוכנית/פרוייקט"

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "בנה את כל הקבצים של התוכנה/פרויקט"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "בנה קובץ"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "בנה את לזרוס"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "תו"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "מחק את כל הטקסט"

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "הגדרת עורך ע\"י CodeTools"

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "אפשרויות CodeTools"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "בחר עמודה למטה"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "בחר עמודה לסוף המוחלט"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "בחר עמודה להתחלה המוחלטת"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "בחר עמודה לשמאל"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "בחר עמודה לסוף שורה"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "בחר עמודה להתחלת שורה"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "בחר עמודה להתחלת הטקסט בשורה"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "בחר עמודה לתחתית הדף"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "בחר עמודה למעבר דף למטה"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "בחר עמודה לראש דף"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "בחר עמודה למעבר דף למעלה"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "בחר עמודה לימין"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "בחר עמודה למעלה"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "בחר עמודה למלה בשמאל"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "בחר עמודה למלה בימין"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "אופן בחירת עמודה"

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "אפשרויות מהדר"

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "השלם קוד"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "הגדר קובץ בנייה"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "העתק את הבחירה ללוח הזמני"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "העתק עורך חלון חדש"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "העתק את העורך לחלון החופשי הבא"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "העתק עורך לחלון החופשי הקודם"

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "כלי מותאם אישית %d"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "גזור את הבחירה אל הלוח הזמני"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "מחק עד התחלת שורה"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "מחק את הקו שבסמן"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "מחק עד סוף השורה"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "מחק תו אחרון"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "מחק עד תחילת מילה"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "מחק שורה נוכחית"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "מחק עד סוף המילה"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "השווה"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "הזז את הסמן לסוף המוחלט"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "הזז את הסמן להתחלה המוחלטת"

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "אפשרויות IDE"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "חשב/שנה"

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "חלץ את הפרוצדורה"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "כלי חיצוני d%"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "הגדרת כלים חצוניים"

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "מצא את הבא"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "מצא את הקצה השני של הבלוק"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "מצא את התחלת הבלוק"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "מצא הצהרה"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "מצא את מקורות המזהה"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "מצא בקבצים"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "מצא את הבא"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "מצא את ההופעה הבאה של המילה"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr "מצא העמסות"

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "מצא את הקודם"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "מצא את ההופעה הקודמת של המילה"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "מצא את הגדרת הפרוצדורה"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "מצא את מתודת הפרוצדורה"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "קפל במיקום הסמן"

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "קפל לרמה d%"

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "לך לעורך d%"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "לך להוראת \"כלול\" של קובץ הכלול הנוכחי"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "לך לשורה מספר"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "לך לסמן d%"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "לך לקואורדינטה XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "נחש IFDEF$ שלא במקומו"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "הכנס ChangeLog"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "הכנס ממפת תווים"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "הכנס מחבר מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "הכנס תאריך מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "הכנס כותרת מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "הכנס זיהוי מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "הכנס לוג מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "הכנס שם מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "הכנס מלת קוד מתוקנת של CVS"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "הכנס מקור מלת קוד של CVS"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "הכנס תאריך וזמן עכשווים"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "הכנס הערת GPL "

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "הוסף GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "הכנס הערת LGPL "

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "פצל שורה , עזוב את הסמן"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "מצב הכנסה"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "הכנס הערת LGPL ששונתה"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "הכנס שם משתמש נוכחי"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "פקח"

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "החלף הצבה"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "פצל את השורה והזז את הסמן"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "הזז את הסמן לסוף השורה"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "מצב בחירת שורה"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "הזז את הסמן להתחלת השורה"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "העבר סמן לטקסט המתחיל בשורה"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "נעל עורך"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "צור מחרוזת משאבים"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "לך לסוגריים המתאימים"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "הזז את העורך שמאלה"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "הצמד את העורך שמאלה"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "העבר עורך לחלון חדש"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "העבר עורך לחלון החופשי הבא"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "העבר עורך לחלון החופשי הקודם"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "הזז את העורך ימינה"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "הצמד את העורך ימינה"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "הסמנייה הבאה"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "לך לעורך הבא"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "גש לעורך הטקסט הבא עם אותו הקוד"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "גש לחלון הבא"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "מצב בחירה רגיל"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "פתח קובץ במיקום הסמן"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "מצב שכתוב"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "הזז את הסמן לתחתית הדף"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "הזז את הסמן דף אחד למטה"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "הזז את הסמן דף אחד שמאלה"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "הזז את הסמן דף אחד ימינה"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "הזז את הסמן לראש הדף"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "הזז את הסמן דף אחד למעלה"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "הדבק מלוח הגזירים למיקום הנוכחי"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "השהה תוכנה"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "סמנייה קודמת"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "לך לעורך קודם"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "גש לעורך הטקסט הקודם עם אותו הקוד"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "גש לחלון הקודם"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "הידור מהיר ללא קישור"

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr "יציאה"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "הסר נקודת עצירה"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "הסר מתודות ריקות"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr "הסר יחידות שאינן בשימוש"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "שנה שם המזהה"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "החלף טקסט"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr "דיווח באג"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "אתחל את מנפה השגיאות"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "הרץ תוכנה"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "הרץ קובץ"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "הרץ פרמטרים"

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "שמור"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "גלול שורה אחת למטה"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "גלול תו אחד שמאלה"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "גלול תו אחד ימינה"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "גלול שורה אחת למעלה"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "בחר למטה"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "בחר הכל"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "המר טאבים לרווחים בבחירה"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "בחר בסוף המוחלט"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "בחר בהתחלה המוחלטת"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "בחר \"לך לקואורדינטות XY\""

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "בחר שמאלה"

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "בחר בסוף שורה"

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "בחר בהתחלת שורה"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "בחירה לטקסט בשורה חדשה"

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "בחר בתחתית הדף"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "בחר דף למטה"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "בחר דף שמאלה"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "בחר דף ימינה"

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "בחר דף עליון"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "בחר דף למעלה"

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "בחר ימינה"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "בחר עליון"

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "בחר מילה אחת שמאלה"

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "בחר מילה אחת ימינה"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "קבע סימניה חופשית"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "קבע סמן d%"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "הזז טאב"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "הראה מתודות מופשטות"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "הראה את הקשר הקוד"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "הצג נקודת ריצה"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "עצור תכנית"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "לך למקום האחרון בתא"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "לך למקום הראשון בתא"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "בחר תא"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "צא"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "התא הבא"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "התא הבא ( הכל נבחר)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "התא קודם"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "התא קודם (הכל נבחר)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "התחל עריכת כל המופעים"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "לך למקום האחרון בתא"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "לך למקום הראשון בתא"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "בחר תא"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "צא"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "סיום"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "התא הבא"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "התא הבא (סובב)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "התא הבא ( הכל נבחר)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "התא הבא (סובב / הכל נבחר)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "התא קודם"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "התא קודם (הכל נבחר)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "בדיקת תחביר"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "הצג אסמבלר"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr "החלף נקודת עצירה"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "הצג נקודות עצירה"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "הצג את מחסנית הקריאות"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "הצג את סייר הקוד"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "הצג את סייר הקוד"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "הצג את פלטת הרכיבים"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "הצג את פלט מנפה השגיאות"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "החלף בין טופס ליחידה"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "הצג את עורך התיעוד"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "הצג את כפתורי ה Speed ב IDE"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "הצג משתנים מקומיים"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "החלף סמן d%"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "החלף  הדגשת מילה נוכחית (כן לא)"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "הצג הודעות"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "החלף אופן"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "הצג את Object Inspector"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "הצג אוגרים"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "הצג את סייר ההגבלות"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "הצג את תוצאות החיפוש"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "הצג את עורך קוד המקור"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "הצג משגיחים"

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "פתח את כל הקיפולים"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "פתח את הקיפולים במיקום הסמן"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "פקודת עורך לא ידועה"

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "קודם המשתמש"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "הצג את עורך המעגנים"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "הצג רכיבים"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "הצג טפסים"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "הצג את תלויות היחידה"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "הצג מידע על היחידה"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "הצג יחידות"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "השלמת מילים"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "הזז את הסמן מילה אחת שמאלה"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "הזז את הסמן מילה אחת ימינה"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "ערוך מקשים של פקודה"

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "ערוך מקש"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "החזק מקש"

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "החזק מקש שני"

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "מקש (או צרוף של שני מקשים)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "לחץ על מקש כלשהו ..."

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "קפל הערות בזמן הבחירה"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "הסתר הערות בזמן הבחירה"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr "פרוש הכל בזמן הבחירה"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr "פרוש הערות בזמן הבחירה"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "הקובץ לקריאה בלבד"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "הקובץ \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" אינו בר כתיבה"

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "נעול"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "הוסף משגיח במיקום הסמן"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "סימניה"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "סגור את כל הדפים האחרים"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "ס&גור את הדף"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "השלם קוד"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "העתק"

#: lazarusidestrconsts.uemcopyfilename
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "העתק שם קובץ"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to new Window"
msgstr "שכפל לחלון חדש"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr "שכפל לחלון אחר"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "חלון חדש"

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "חתוך"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "נפה שגיאות"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "תכונות עורך"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "צרף בחירה"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "קידוד"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr "הער&ך/שנה"

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "חלץ פרוצדורה"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "מצא הצהרה"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "מצא מקור המזהה"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "לך לסימניה"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "מדגש"

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr "פ&קח"

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "הפוך הצבה"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "סוף שורה"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "נ&על דף"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "הזז את הדף שמאלה"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "הצמד את הדף לשמאל"

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "הזז את הדף ימינה"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "הצמד את הדף לימין"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "העבר לחלון חדש"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr "העבר לחלון אחר"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "חלון חדש"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "לך לסימניה הבאה"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "שונה"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "פתח &קובץ במיקום הסמן"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "הדבק"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "לך לסימניה קודמת"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "קפיצה לפרוצדורה"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "קריאה בלבד"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "סידור מחדש"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "שנה את שם המזהה"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "הרץ &עד לסמן"

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "קבע סימניה"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "קבע סימניה חופשית"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "הראה מספרי שורה"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "מידע על היחידה"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "החלף סימניה"

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr "החלף נקודת עצירה"

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "הצג את מחסנית הקריאות"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "לא ממומש עדיין"

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "אמרתי לך: לא ממומש עדיין"

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "אם אתה יכול לעזור לנו במימוש תכונה זאת שלח דואר ל lazarus@miraclec.com"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "הכנס"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "קריאה בלבד"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "מידע אודות הגרסה"