/usr/lib/lazarus/0.9.30.4/languages/lazaruside.fr.po is in lazarus-ide-0.9.30.4 0.9.30.4-6.
This file is owned by root:root, with mode 0o644.
The actual contents of the file can be viewed below.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151 3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193 3194 3195 3196 3197 3198 3199 3200 3201 3202 3203 3204 3205 3206 3207 3208 3209 3210 3211 3212 3213 3214 3215 3216 3217 3218 3219 3220 3221 3222 3223 3224 3225 3226 3227 3228 3229 3230 3231 3232 3233 3234 3235 3236 3237 3238 3239 3240 3241 3242 3243 3244 3245 3246 3247 3248 3249 3250 3251 3252 3253 3254 3255 3256 3257 3258 3259 3260 3261 3262 3263 3264 3265 3266 3267 3268 3269 3270 3271 3272 3273 3274 3275 3276 3277 3278 3279 3280 3281 3282 3283 3284 3285 3286 3287 3288 3289 3290 3291 3292 3293 3294 3295 3296 3297 3298 3299 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3332 3333 3334 3335 3336 3337 3338 3339 3340 3341 3342 3343 3344 3345 3346 3347 3348 3349 3350 3351 3352 3353 3354 3355 3356 3357 3358 3359 3360 3361 3362 3363 3364 3365 3366 3367 3368 3369 3370 3371 3372 3373 3374 3375 3376 3377 3378 3379 3380 3381 3382 3383 3384 3385 3386 3387 3388 3389 3390 3391 3392 3393 3394 3395 3396 3397 3398 3399 3400 3401 3402 3403 3404 3405 3406 3407 3408 3409 3410 3411 3412 3413 3414 3415 3416 3417 3418 3419 3420 3421 3422 3423 3424 3425 3426 3427 3428 3429 3430 3431 3432 3433 3434 3435 3436 3437 3438 3439 3440 3441 3442 3443 3444 3445 3446 3447 3448 3449 3450 3451 3452 3453 3454 3455 3456 3457 3458 3459 3460 3461 3462 3463 3464 3465 3466 3467 3468 3469 3470 3471 3472 3473 3474 3475 3476 3477 3478 3479 3480 3481 3482 3483 3484 3485 3486 3487 3488 3489 3490 3491 3492 3493 3494 3495 3496 3497 3498 3499 3500 3501 3502 3503 3504 3505 3506 3507 3508 3509 3510 3511 3512 3513 3514 3515 3516 3517 3518 3519 3520 3521 3522 3523 3524 3525 3526 3527 3528 3529 3530 3531 3532 3533 3534 3535 3536 3537 3538 3539 3540 3541 3542 3543 3544 3545 3546 3547 3548 3549 3550 3551 3552 3553 3554 3555 3556 3557 3558 3559 3560 3561 3562 3563 3564 3565 3566 3567 3568 3569 3570 3571 3572 3573 3574 3575 3576 3577 3578 3579 3580 3581 3582 3583 3584 3585 3586 3587 3588 3589 3590 3591 3592 3593 3594 3595 3596 3597 3598 3599 3600 3601 3602 3603 3604 3605 3606 3607 3608 3609 3610 3611 3612 3613 3614 3615 3616 3617 3618 3619 3620 3621 3622 3623 3624 3625 3626 3627 3628 3629 3630 3631 3632 3633 3634 3635 3636 3637 3638 3639 3640 3641 3642 3643 3644 3645 3646 3647 3648 3649 3650 3651 3652 3653 3654 3655 3656 3657 3658 3659 3660 3661 3662 3663 3664 3665 3666 3667 3668 3669 3670 3671 3672 3673 3674 3675 3676 3677 3678 3679 3680 3681 3682 3683 3684 3685 3686 3687 3688 3689 3690 3691 3692 3693 3694 3695 3696 3697 3698 3699 3700 3701 3702 3703 3704 3705 3706 3707 3708 3709 3710 3711 3712 3713 3714 3715 3716 3717 3718 3719 3720 3721 3722 3723 3724 3725 3726 3727 3728 3729 3730 3731 3732 3733 3734 3735 3736 3737 3738 3739 3740 3741 3742 3743 3744 3745 3746 3747 3748 3749 3750 3751 3752 3753 3754 3755 3756 3757 3758 3759 3760 3761 3762 3763 3764 3765 3766 3767 3768 3769 3770 3771 3772 3773 3774 3775 3776 3777 3778 3779 3780 3781 3782 3783 3784 3785 3786 3787 3788 3789 3790 3791 3792 3793 3794 3795 3796 3797 3798 3799 3800 3801 3802 3803 3804 3805 3806 3807 3808 3809 3810 3811 3812 3813 3814 3815 3816 3817 3818 3819 3820 3821 3822 3823 3824 3825 3826 3827 3828 3829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845 3846 3847 3848 3849 3850 3851 3852 3853 3854 3855 3856 3857 3858 3859 3860 3861 3862 3863 3864 3865 3866 3867 3868 3869 3870 3871 3872 3873 3874 3875 3876 3877 3878 3879 3880 3881 3882 3883 3884 3885 3886 3887 3888 3889 3890 3891 3892 3893 3894 3895 3896 3897 3898 3899 3900 3901 3902 3903 3904 3905 3906 3907 3908 3909 3910 3911 3912 3913 3914 3915 3916 3917 3918 3919 3920 3921 3922 3923 3924 3925 3926 3927 3928 3929 3930 3931 3932 3933 3934 3935 3936 3937 3938 3939 3940 3941 3942 3943 3944 3945 3946 3947 3948 3949 3950 3951 3952 3953 3954 3955 3956 3957 3958 3959 3960 3961 3962 3963 3964 3965 3966 3967 3968 3969 3970 3971 3972 3973 3974 3975 3976 3977 3978 3979 3980 3981 3982 3983 3984 3985 3986 3987 3988 3989 3990 3991 3992 3993 3994 3995 3996 3997 3998 3999 4000 4001 4002 4003 4004 4005 4006 4007 4008 4009 4010 4011 4012 4013 4014 4015 4016 4017 4018 4019 4020 4021 4022 4023 4024 4025 4026 4027 4028 4029 4030 4031 4032 4033 4034 4035 4036 4037 4038 4039 4040 4041 4042 4043 4044 4045 4046 4047 4048 4049 4050 4051 4052 4053 4054 4055 4056 4057 4058 4059 4060 4061 4062 4063 4064 4065 4066 4067 4068 4069 4070 4071 4072 4073 4074 4075 4076 4077 4078 4079 4080 4081 4082 4083 4084 4085 4086 4087 4088 4089 4090 4091 4092 4093 4094 4095 4096 4097 4098 4099 4100 4101 4102 4103 4104 4105 4106 4107 4108 4109 4110 4111 4112 4113 4114 4115 4116 4117 4118 4119 4120 4121 4122 4123 4124 4125 4126 4127 4128 4129 4130 4131 4132 4133 4134 4135 4136 4137 4138 4139 4140 4141 4142 4143 4144 4145 4146 4147 4148 4149 4150 4151 4152 4153 4154 4155 4156 4157 4158 4159 4160 4161 4162 4163 4164 4165 4166 4167 4168 4169 4170 4171 4172 4173 4174 4175 4176 4177 4178 4179 4180 4181 4182 4183 4184 4185 4186 4187 4188 4189 4190 4191 4192 4193 4194 4195 4196 4197 4198 4199 4200 4201 4202 4203 4204 4205 4206 4207 4208 4209 4210 4211 4212 4213 4214 4215 4216 4217 4218 4219 4220 4221 4222 4223 4224 4225 4226 4227 4228 4229 4230 4231 4232 4233 4234 4235 4236 4237 4238 4239 4240 4241 4242 4243 4244 4245 4246 4247 4248 4249 4250 4251 4252 4253 4254 4255 4256 4257 4258 4259 4260 4261 4262 4263 4264 4265 4266 4267 4268 4269 4270 4271 4272 4273 4274 4275 4276 4277 4278 4279 4280 4281 4282 4283 4284 4285 4286 4287 4288 4289 4290 4291 4292 4293 4294 4295 4296 4297 4298 4299 4300 4301 4302 4303 4304 4305 4306 4307 4308 4309 4310 4311 4312 4313 4314 4315 4316 4317 4318 4319 4320 4321 4322 4323 4324 4325 4326 4327 4328 4329 4330 4331 4332 4333 4334 4335 4336 4337 4338 4339 4340 4341 4342 4343 4344 4345 4346 4347 4348 4349 4350 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387 4388 4389 4390 4391 4392 4393 4394 4395 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 4413 4414 4415 4416 4417 4418 4419 4420 4421 4422 4423 4424 4425 4426 4427 4428 4429 4430 4431 4432 4433 4434 4435 4436 4437 4438 4439 4440 4441 4442 4443 4444 4445 4446 4447 4448 4449 4450 4451 4452 4453 4454 4455 4456 4457 4458 4459 4460 4461 4462 4463 4464 4465 4466 4467 4468 4469 4470 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4483 4484 4485 4486 4487 4488 4489 4490 4491 4492 4493 4494 4495 4496 4497 4498 4499 4500 4501 4502 4503 4504 4505 4506 4507 4508 4509 4510 4511 4512 4513 4514 4515 4516 4517 4518 4519 4520 4521 4522 4523 4524 4525 4526 4527 4528 4529 4530 4531 4532 4533 4534 4535 4536 4537 4538 4539 4540 4541 4542 4543 4544 4545 4546 4547 4548 4549 4550 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4645 4646 4647 4648 4649 4650 4651 4652 4653 4654 4655 4656 4657 4658 4659 4660 4661 4662 4663 4664 4665 4666 4667 4668 4669 4670 4671 4672 4673 4674 4675 4676 4677 4678 4679 4680 4681 4682 4683 4684 4685 4686 4687 4688 4689 4690 4691 4692 4693 4694 4695 4696 4697 4698 4699 4700 4701 4702 4703 4704 4705 4706 4707 4708 4709 4710 4711 4712 4713 4714 4715 4716 4717 4718 4719 4720 4721 4722 4723 4724 4725 4726 4727 4728 4729 4730 4731 4732 4733 4734 4735 4736 4737 4738 4739 4740 4741 4742 4743 4744 4745 4746 4747 4748 4749 4750 4751 4752 4753 4754 4755 4756 4757 4758 4759 4760 4761 4762 4763 4764 4765 4766 4767 4768 4769 4770 4771 4772 4773 4774 4775 4776 4777 4778 4779 4780 4781 4782 4783 4784 4785 4786 4787 4788 4789 4790 4791 4792 4793 4794 4795 4796 4797 4798 4799 4800 4801 4802 4803 4804 4805 4806 4807 4808 4809 4810 4811 4812 4813 4814 4815 4816 4817 4818 4819 4820 4821 4822 4823 4824 4825 4826 4827 4828 4829 4830 4831 4832 4833 4834 4835 4836 4837 4838 4839 4840 4841 4842 4843 4844 4845 4846 4847 4848 4849 4850 4851 4852 4853 4854 4855 4856 4857 4858 4859 4860 4861 4862 4863 4864 4865 4866 4867 4868 4869 4870 4871 4872 4873 4874 4875 4876 4877 4878 4879 4880 4881 4882 4883 4884 4885 4886 4887 4888 4889 4890 4891 4892 4893 4894 4895 4896 4897 4898 4899 4900 4901 4902 4903 4904 4905 4906 4907 4908 4909 4910 4911 4912 4913 4914 4915 4916 4917 4918 4919 4920 4921 4922 4923 4924 4925 4926 4927 4928 4929 4930 4931 4932 4933 4934 4935 4936 4937 4938 4939 4940 4941 4942 4943 4944 4945 4946 4947 4948 4949 4950 4951 4952 4953 4954 4955 4956 4957 4958 4959 4960 4961 4962 4963 4964 4965 4966 4967 4968 4969 4970 4971 4972 4973 4974 4975 4976 4977 4978 4979 4980 4981 4982 4983 4984 4985 4986 4987 4988 4989 4990 4991 4992 4993 4994 4995 4996 4997 4998 4999 5000 5001 5002 5003 5004 5005 5006 5007 5008 5009 5010 5011 5012 5013 5014 5015 5016 5017 5018 5019 5020 5021 5022 5023 5024 5025 5026 5027 5028 5029 5030 5031 5032 5033 5034 5035 5036 5037 5038 5039 5040 5041 5042 5043 5044 5045 5046 5047 5048 5049 5050 5051 5052 5053 5054 5055 5056 5057 5058 5059 5060 5061 5062 5063 5064 5065 5066 5067 5068 5069 5070 5071 5072 5073 5074 5075 5076 5077 5078 5079 5080 5081 5082 5083 5084 5085 5086 5087 5088 5089 5090 5091 5092 5093 5094 5095 5096 5097 5098 5099 5100 5101 5102 5103 5104 5105 5106 5107 5108 5109 5110 5111 5112 5113 5114 5115 5116 5117 5118 5119 5120 5121 5122 5123 5124 5125 5126 5127 5128 5129 5130 5131 5132 5133 5134 5135 5136 5137 5138 5139 5140 5141 5142 5143 5144 5145 5146 5147 5148 5149 5150 5151 5152 5153 5154 5155 5156 5157 5158 5159 5160 5161 5162 5163 5164 5165 5166 5167 5168 5169 5170 5171 5172 5173 5174 5175 5176 5177 5178 5179 5180 5181 5182 5183 5184 5185 5186 5187 5188 5189 5190 5191 5192 5193 5194 5195 5196 5197 5198 5199 5200 5201 5202 5203 5204 5205 5206 5207 5208 5209 5210 5211 5212 5213 5214 5215 5216 5217 5218 5219 5220 5221 5222 5223 5224 5225 5226 5227 5228 5229 5230 5231 5232 5233 5234 5235 5236 5237 5238 5239 5240 5241 5242 5243 5244 5245 5246 5247 5248 5249 5250 5251 5252 5253 5254 5255 5256 5257 5258 5259 5260 5261 5262 5263 5264 5265 5266 5267 5268 5269 5270 5271 5272 5273 5274 5275 5276 5277 5278 5279 5280 5281 5282 5283 5284 5285 5286 5287 5288 5289 5290 5291 5292 5293 5294 5295 5296 5297 5298 5299 5300 5301 5302 5303 5304 5305 5306 5307 5308 5309 5310 5311 5312 5313 5314 5315 5316 5317 5318 5319 5320 5321 5322 5323 5324 5325 5326 5327 5328 5329 5330 5331 5332 5333 5334 5335 5336 5337 5338 5339 5340 5341 5342 5343 5344 5345 5346 5347 5348 5349 5350 5351 5352 5353 5354 5355 5356 5357 5358 5359 5360 5361 5362 5363 5364 5365 5366 5367 5368 5369 5370 5371 5372 5373 5374 5375 5376 5377 5378 5379 5380 5381 5382 5383 5384 5385 5386 5387 5388 5389 5390 5391 5392 5393 5394 5395 5396 5397 5398 5399 5400 5401 5402 5403 5404 5405 5406 5407 5408 5409 5410 5411 5412 5413 5414 5415 5416 5417 5418 5419 5420 5421 5422 5423 5424 5425 5426 5427 5428 5429 5430 5431 5432 5433 5434 5435 5436 5437 5438 5439 5440 5441 5442 5443 5444 5445 5446 5447 5448 5449 5450 5451 5452 5453 5454 5455 5456 5457 5458 5459 5460 5461 5462 5463 5464 5465 5466 5467 5468 5469 5470 5471 5472 5473 5474 5475 5476 5477 5478 5479 5480 5481 5482 5483 5484 5485 5486 5487 5488 5489 5490 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 5531 5532 5533 5534 5535 5536 5537 5538 5539 5540 5541 5542 5543 5544 5545 5546 5547 5548 5549 5550 5551 5552 5553 5554 5555 5556 5557 5558 5559 5560 5561 5562 5563 5564 5565 5566 5567 5568 5569 5570 5571 5572 5573 5574 5575 5576 5577 5578 5579 5580 5581 5582 5583 5584 5585 5586 5587 5588 5589 5590 5591 5592 5593 5594 5595 5596 5597 5598 5599 5600 5601 5602 5603 5604 5605 5606 5607 5608 5609 5610 5611 5612 5613 5614 5615 5616 5617 5618 5619 5620 5621 5622 5623 5624 5625 5626 5627 5628 5629 5630 5631 5632 5633 5634 5635 5636 5637 5638 5639 5640 5641 5642 5643 5644 5645 5646 5647 5648 5649 5650 5651 5652 5653 5654 5655 5656 5657 5658 5659 5660 5661 5662 5663 5664 5665 5666 5667 5668 5669 5670 5671 5672 5673 5674 5675 5676 5677 5678 5679 5680 5681 5682 5683 5684 5685 5686 5687 5688 5689 5690 5691 5692 5693 5694 5695 5696 5697 5698 5699 5700 5701 5702 5703 5704 5705 5706 5707 5708 5709 5710 5711 5712 5713 5714 5715 5716 5717 5718 5719 5720 5721 5722 5723 5724 5725 5726 5727 5728 5729 5730 5731 5732 5733 5734 5735 5736 5737 5738 5739 5740 5741 5742 5743 5744 5745 5746 5747 5748 5749 5750 5751 5752 5753 5754 5755 5756 5757 5758 5759 5760 5761 5762 5763 5764 5765 5766 5767 5768 5769 5770 5771 5772 5773 5774 5775 5776 5777 5778 5779 5780 5781 5782 5783 5784 5785 5786 5787 5788 5789 5790 5791 5792 5793 5794 5795 5796 5797 5798 5799 5800 5801 5802 5803 5804 5805 5806 5807 5808 5809 5810 5811 5812 5813 5814 5815 5816 5817 5818 5819 5820 5821 5822 5823 5824 5825 5826 5827 5828 5829 5830 5831 5832 5833 5834 5835 5836 5837 5838 5839 5840 5841 5842 5843 5844 5845 5846 5847 5848 5849 5850 5851 5852 5853 5854 5855 5856 5857 5858 5859 5860 5861 5862 5863 5864 5865 5866 5867 5868 5869 5870 5871 5872 5873 5874 5875 5876 5877 5878 5879 5880 5881 5882 5883 5884 5885 5886 5887 5888 5889 5890 5891 5892 5893 5894 5895 5896 5897 5898 5899 5900 5901 5902 5903 5904 5905 5906 5907 5908 5909 5910 5911 5912 5913 5914 5915 5916 5917 5918 5919 5920 5921 5922 5923 5924 5925 5926 5927 5928 5929 5930 5931 5932 5933 5934 5935 5936 5937 5938 5939 5940 5941 5942 5943 5944 5945 5946 5947 5948 5949 5950 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 6044 6045 6046 6047 6048 6049 6050 6051 6052 6053 6054 6055 6056 6057 6058 6059 6060 6061 6062 6063 6064 6065 6066 6067 6068 6069 6070 6071 6072 6073 6074 6075 6076 6077 6078 6079 6080 6081 6082 6083 6084 6085 6086 6087 6088 6089 6090 6091 6092 6093 6094 6095 6096 6097 6098 6099 6100 6101 6102 6103 6104 6105 6106 6107 6108 6109 6110 6111 6112 6113 6114 6115 6116 6117 6118 6119 6120 6121 6122 6123 6124 6125 6126 6127 6128 6129 6130 6131 6132 6133 6134 6135 6136 6137 6138 6139 6140 6141 6142 6143 6144 6145 6146 6147 6148 6149 6150 6151 6152 6153 6154 6155 6156 6157 6158 6159 6160 6161 6162 6163 6164 6165 6166 6167 6168 6169 6170 6171 6172 6173 6174 6175 6176 6177 6178 6179 6180 6181 6182 6183 6184 6185 6186 6187 6188 6189 6190 6191 6192 6193 6194 6195 6196 6197 6198 6199 6200 6201 6202 6203 6204 6205 6206 6207 6208 6209 6210 6211 6212 6213 6214 6215 6216 6217 6218 6219 6220 6221 6222 6223 6224 6225 6226 6227 6228 6229 6230 6231 6232 6233 6234 6235 6236 6237 6238 6239 6240 6241 6242 6243 6244 6245 6246 6247 6248 6249 6250 6251 6252 6253 6254 6255 6256 6257 6258 6259 6260 6261 6262 6263 6264 6265 6266 6267 6268 6269 6270 6271 6272 6273 6274 6275 6276 6277 6278 6279 6280 6281 6282 6283 6284 6285 6286 6287 6288 6289 6290 6291 6292 6293 6294 6295 6296 6297 6298 6299 6300 6301 6302 6303 6304 6305 6306 6307 6308 6309 6310 6311 6312 6313 6314 6315 6316 6317 6318 6319 6320 6321 6322 6323 6324 6325 6326 6327 6328 6329 6330 6331 6332 6333 6334 6335 6336 6337 6338 6339 6340 6341 6342 6343 6344 6345 6346 6347 6348 6349 6350 6351 6352 6353 6354 6355 6356 6357 6358 6359 6360 6361 6362 6363 6364 6365 6366 6367 6368 6369 6370 6371 6372 6373 6374 6375 6376 6377 6378 6379 6380 6381 6382 6383 6384 6385 6386 6387 6388 6389 6390 6391 6392 6393 6394 6395 6396 6397 6398 6399 6400 6401 6402 6403 6404 6405 6406 6407 6408 6409 6410 6411 6412 6413 6414 6415 6416 6417 6418 6419 6420 6421 6422 6423 6424 6425 6426 6427 6428 6429 6430 6431 6432 6433 6434 6435 6436 6437 6438 6439 6440 6441 6442 6443 6444 6445 6446 6447 6448 6449 6450 6451 6452 6453 6454 6455 6456 6457 6458 6459 6460 6461 6462 6463 6464 6465 6466 6467 6468 6469 6470 6471 6472 6473 6474 6475 6476 6477 6478 6479 6480 6481 6482 6483 6484 6485 6486 6487 6488 6489 6490 6491 6492 6493 6494 6495 6496 6497 6498 6499 6500 6501 6502 6503 6504 6505 6506 6507 6508 6509 6510 6511 6512 6513 6514 6515 6516 6517 6518 6519 6520 6521 6522 6523 6524 6525 6526 6527 6528 6529 6530 6531 6532 6533 6534 6535 6536 6537 6538 6539 6540 6541 6542 6543 6544 6545 6546 6547 6548 6549 6550 6551 6552 6553 6554 6555 6556 6557 6558 6559 6560 6561 6562 6563 6564 6565 6566 6567 6568 6569 6570 6571 6572 6573 6574 6575 6576 6577 6578 6579 6580 6581 6582 6583 6584 6585 6586 6587 6588 6589 6590 6591 6592 6593 6594 6595 6596 6597 6598 6599 6600 6601 6602 6603 6604 6605 6606 6607 6608 6609 6610 6611 6612 6613 6614 6615 6616 6617 6618 6619 6620 6621 6622 6623 6624 6625 6626 6627 6628 6629 6630 6631 6632 6633 6634 6635 6636 6637 6638 6639 6640 6641 6642 6643 6644 6645 6646 6647 6648 6649 6650 6651 6652 6653 6654 6655 6656 6657 6658 6659 6660 6661 6662 6663 6664 6665 6666 6667 6668 6669 6670 6671 6672 6673 6674 6675 6676 6677 6678 6679 6680 6681 6682 6683 6684 6685 6686 6687 6688 6689 6690 6691 6692 6693 6694 6695 6696 6697 6698 6699 6700 6701 6702 6703 6704 6705 6706 6707 6708 6709 6710 6711 6712 6713 6714 6715 6716 6717 6718 6719 6720 6721 6722 6723 6724 6725 6726 6727 6728 6729 6730 6731 6732 6733 6734 6735 6736 6737 6738 6739 6740 6741 6742 6743 6744 6745 6746 6747 6748 6749 6750 6751 6752 6753 6754 6755 6756 6757 6758 6759 6760 6761 6762 6763 6764 6765 6766 6767 6768 6769 6770 6771 6772 6773 6774 6775 6776 6777 6778 6779 6780 6781 6782 6783 6784 6785 6786 6787 6788 6789 6790 6791 6792 6793 6794 6795 6796 6797 6798 6799 6800 6801 6802 6803 6804 6805 6806 6807 6808 6809 6810 6811 6812 6813 6814 6815 6816 6817 6818 6819 6820 6821 6822 6823 6824 6825 6826 6827 6828 6829 6830 6831 6832 6833 6834 6835 6836 6837 6838 6839 6840 6841 6842 6843 6844 6845 6846 6847 6848 6849 6850 6851 6852 6853 6854 6855 6856 6857 6858 6859 6860 6861 6862 6863 6864 6865 6866 6867 6868 6869 6870 6871 6872 6873 6874 6875 6876 6877 6878 6879 6880 6881 6882 6883 6884 6885 6886 6887 6888 6889 6890 6891 6892 6893 6894 6895 6896 6897 6898 6899 6900 6901 6902 6903 6904 6905 6906 6907 6908 6909 6910 6911 6912 6913 6914 6915 6916 6917 6918 6919 6920 6921 6922 6923 6924 6925 6926 6927 6928 6929 6930 6931 6932 6933 6934 6935 6936 6937 6938 6939 6940 6941 6942 6943 6944 6945 6946 6947 6948 6949 6950 6951 6952 6953 6954 6955 6956 6957 6958 6959 6960 6961 6962 6963 6964 6965 6966 6967 6968 6969 6970 6971 6972 6973 6974 6975 6976 6977 6978 6979 6980 6981 6982 6983 6984 6985 6986 6987 6988 6989 6990 6991 6992 6993 6994 6995 6996 6997 6998 6999 7000 7001 7002 7003 7004 7005 7006 7007 7008 7009 7010 7011 7012 7013 7014 7015 7016 7017 7018 7019 7020 7021 7022 7023 7024 7025 7026 7027 7028 7029 7030 7031 7032 7033 7034 7035 7036 7037 7038 7039 7040 7041 7042 7043 7044 7045 7046 7047 7048 7049 7050 7051 7052 7053 7054 7055 7056 7057 7058 7059 7060 7061 7062 7063 7064 7065 7066 7067 7068 7069 7070 7071 7072 7073 7074 7075 7076 7077 7078 7079 7080 7081 7082 7083 7084 7085 7086 7087 7088 7089 7090 7091 7092 7093 7094 7095 7096 7097 7098 7099 7100 7101 7102 7103 7104 7105 7106 7107 7108 7109 7110 7111 7112 7113 7114 7115 7116 7117 7118 7119 7120 7121 7122 7123 7124 7125 7126 7127 7128 7129 7130 7131 7132 7133 7134 7135 7136 7137 7138 7139 7140 7141 7142 7143 7144 7145 7146 7147 7148 7149 7150 7151 7152 7153 7154 7155 7156 7157 7158 7159 7160 7161 7162 7163 7164 7165 7166 7167 7168 7169 7170 7171 7172 7173 7174 7175 7176 7177 7178 7179 7180 7181 7182 7183 7184 7185 7186 7187 7188 7189 7190 7191 7192 7193 7194 7195 7196 7197 7198 7199 7200 7201 7202 7203 7204 7205 7206 7207 7208 7209 7210 7211 7212 7213 7214 7215 7216 7217 7218 7219 7220 7221 7222 7223 7224 7225 7226 7227 7228 7229 7230 7231 7232 7233 7234 7235 7236 7237 7238 7239 7240 7241 7242 7243 7244 7245 7246 7247 7248 7249 7250 7251 7252 7253 7254 7255 7256 7257 7258 7259 7260 7261 7262 7263 7264 7265 7266 7267 7268 7269 7270 7271 7272 7273 7274 7275 7276 7277 7278 7279 7280 7281 7282 7283 7284 7285 7286 7287 7288 7289 7290 7291 7292 7293 7294 7295 7296 7297 7298 7299 7300 7301 7302 7303 7304 7305 7306 7307 7308 7309 7310 7311 7312 7313 7314 7315 7316 7317 7318 7319 7320 7321 7322 7323 7324 7325 7326 7327 7328 7329 7330 7331 7332 7333 7334 7335 7336 7337 7338 7339 7340 7341 7342 7343 7344 7345 7346 7347 7348 7349 7350 7351 7352 7353 7354 7355 7356 7357 7358 7359 7360 7361 7362 7363 7364 7365 7366 7367 7368 7369 7370 7371 7372 7373 7374 7375 7376 7377 7378 7379 7380 7381 7382 7383 7384 7385 7386 7387 7388 7389 7390 7391 7392 7393 7394 7395 7396 7397 7398 7399 7400 7401 7402 7403 7404 7405 7406 7407 7408 7409 7410 7411 7412 7413 7414 7415 7416 7417 7418 7419 7420 7421 7422 7423 7424 7425 7426 7427 7428 7429 7430 7431 7432 7433 7434 7435 7436 7437 7438 7439 7440 7441 7442 7443 7444 7445 7446 7447 7448 7449 7450 7451 7452 7453 7454 7455 7456 7457 7458 7459 7460 7461 7462 7463 7464 7465 7466 7467 7468 7469 7470 7471 7472 7473 7474 7475 7476 7477 7478 7479 7480 7481 7482 7483 7484 7485 7486 7487 7488 7489 7490 7491 7492 7493 7494 7495 7496 7497 7498 7499 7500 7501 7502 7503 7504 7505 7506 7507 7508 7509 7510 7511 7512 7513 7514 7515 7516 7517 7518 7519 7520 7521 7522 7523 7524 7525 7526 7527 7528 7529 7530 7531 7532 7533 7534 7535 7536 7537 7538 7539 7540 7541 7542 7543 7544 7545 7546 7547 7548 7549 7550 7551 7552 7553 7554 7555 7556 7557 7558 7559 7560 7561 7562 7563 7564 7565 7566 7567 7568 7569 7570 7571 7572 7573 7574 7575 7576 7577 7578 7579 7580 7581 7582 7583 7584 7585 7586 7587 7588 7589 7590 7591 7592 7593 7594 7595 7596 7597 7598 7599 7600 7601 7602 7603 7604 7605 7606 7607 7608 7609 7610 7611 7612 7613 7614 7615 7616 7617 7618 7619 7620 7621 7622 7623 7624 7625 7626 7627 7628 7629 7630 7631 7632 7633 7634 7635 7636 7637 7638 7639 7640 7641 7642 7643 7644 7645 7646 7647 7648 7649 7650 7651 7652 7653 7654 7655 7656 7657 7658 7659 7660 7661 7662 7663 7664 7665 7666 7667 7668 7669 7670 7671 7672 7673 7674 7675 7676 7677 7678 7679 7680 7681 7682 7683 7684 7685 7686 7687 7688 7689 7690 7691 7692 7693 7694 7695 7696 7697 7698 7699 7700 7701 7702 7703 7704 7705 7706 7707 7708 7709 7710 7711 7712 7713 7714 7715 7716 7717 7718 7719 7720 7721 7722 7723 7724 7725 7726 7727 7728 7729 7730 7731 7732 7733 7734 7735 7736 7737 7738 7739 7740 7741 7742 7743 7744 7745 7746 7747 7748 7749 7750 7751 7752 7753 7754 7755 7756 7757 7758 7759 7760 7761 7762 7763 7764 7765 7766 7767 7768 7769 7770 7771 7772 7773 7774 7775 7776 7777 7778 7779 7780 7781 7782 7783 7784 7785 7786 7787 7788 7789 7790 7791 7792 7793 7794 7795 7796 7797 7798 7799 7800 7801 7802 7803 7804 7805 7806 7807 7808 7809 7810 7811 7812 7813 7814 7815 7816 7817 7818 7819 7820 7821 7822 7823 7824 7825 7826 7827 7828 7829 7830 7831 7832 7833 7834 7835 7836 7837 7838 7839 7840 7841 7842 7843 7844 7845 7846 7847 7848 7849 7850 7851 7852 7853 7854 7855 7856 7857 7858 7859 7860 7861 7862 7863 7864 7865 7866 7867 7868 7869 7870 7871 7872 7873 7874 7875 7876 7877 7878 7879 7880 7881 7882 7883 7884 7885 7886 7887 7888 7889 7890 7891 7892 7893 7894 7895 7896 7897 7898 7899 7900 7901 7902 7903 7904 7905 7906 7907 7908 7909 7910 7911 7912 7913 7914 7915 7916 7917 7918 7919 7920 7921 7922 7923 7924 7925 7926 7927 7928 7929 7930 7931 7932 7933 7934 7935 7936 7937 7938 7939 7940 7941 7942 7943 7944 7945 7946 7947 7948 7949 7950 7951 7952 7953 7954 7955 7956 7957 7958 7959 7960 7961 7962 7963 7964 7965 7966 7967 7968 7969 7970 7971 7972 7973 7974 7975 7976 7977 7978 7979 7980 7981 7982 7983 7984 7985 7986 7987 7988 7989 7990 7991 7992 7993 7994 7995 7996 7997 7998 7999 8000 8001 8002 8003 8004 8005 8006 8007 8008 8009 8010 8011 8012 8013 8014 8015 8016 8017 8018 8019 8020 8021 8022 8023 8024 8025 8026 8027 8028 8029 8030 8031 8032 8033 8034 8035 8036 8037 8038 8039 8040 8041 8042 8043 8044 8045 8046 8047 8048 8049 8050 8051 8052 8053 8054 8055 8056 8057 8058 8059 8060 8061 8062 8063 8064 8065 8066 8067 8068 8069 8070 8071 8072 8073 8074 8075 8076 8077 8078 8079 8080 8081 8082 8083 8084 8085 8086 8087 8088 8089 8090 8091 8092 8093 8094 8095 8096 8097 8098 8099 8100 8101 8102 8103 8104 8105 8106 8107 8108 8109 8110 8111 8112 8113 8114 8115 8116 8117 8118 8119 8120 8121 8122 8123 8124 8125 8126 8127 8128 8129 8130 8131 8132 8133 8134 8135 8136 8137 8138 8139 8140 8141 8142 8143 8144 8145 8146 8147 8148 8149 8150 8151 8152 8153 8154 8155 8156 8157 8158 8159 8160 8161 8162 8163 8164 8165 8166 8167 8168 8169 8170 8171 8172 8173 8174 8175 8176 8177 8178 8179 8180 8181 8182 8183 8184 8185 8186 8187 8188 8189 8190 8191 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8203 8204 8205 8206 8207 8208 8209 8210 8211 8212 8213 8214 8215 8216 8217 8218 8219 8220 8221 8222 8223 8224 8225 8226 8227 8228 8229 8230 8231 8232 8233 8234 8235 8236 8237 8238 8239 8240 8241 8242 8243 8244 8245 8246 8247 8248 8249 8250 8251 8252 8253 8254 8255 8256 8257 8258 8259 8260 8261 8262 8263 8264 8265 8266 8267 8268 8269 8270 8271 8272 8273 8274 8275 8276 8277 8278 8279 8280 8281 8282 8283 8284 8285 8286 8287 8288 8289 8290 8291 8292 8293 8294 8295 8296 8297 8298 8299 8300 8301 8302 8303 8304 8305 8306 8307 8308 8309 8310 8311 8312 8313 8314 8315 8316 8317 8318 8319 8320 8321 8322 8323 8324 8325 8326 8327 8328 8329 8330 8331 8332 8333 8334 8335 8336 8337 8338 8339 8340 8341 8342 8343 8344 8345 8346 8347 8348 8349 8350 8351 8352 8353 8354 8355 8356 8357 8358 8359 8360 8361 8362 8363 8364 8365 8366 8367 8368 8369 8370 8371 8372 8373 8374 8375 8376 8377 8378 8379 8380 8381 8382 8383 8384 8385 8386 8387 8388 8389 8390 8391 8392 8393 8394 8395 8396 8397 8398 8399 8400 8401 8402 8403 8404 8405 8406 8407 8408 8409 8410 8411 8412 8413 8414 8415 8416 8417 8418 8419 8420 8421 8422 8423 8424 8425 8426 8427 8428 8429 8430 8431 8432 8433 8434 8435 8436 8437 8438 8439 8440 8441 8442 8443 8444 8445 8446 8447 8448 8449 8450 8451 8452 8453 8454 8455 8456 8457 8458 8459 8460 8461 8462 8463 8464 8465 8466 8467 8468 8469 8470 8471 8472 8473 8474 8475 8476 8477 8478 8479 8480 8481 8482 8483 8484 8485 8486 8487 8488 8489 8490 8491 8492 8493 8494 8495 8496 8497 8498 8499 8500 8501 8502 8503 8504 8505 8506 8507 8508 8509 8510 8511 8512 8513 8514 8515 8516 8517 8518 8519 8520 8521 8522 8523 8524 8525 8526 8527 8528 8529 8530 8531 8532 8533 8534 8535 8536 8537 8538 8539 8540 8541 8542 8543 8544 8545 8546 8547 8548 8549 8550 8551 8552 8553 8554 8555 8556 8557 8558 8559 8560 8561 8562 8563 8564 8565 8566 8567 8568 8569 8570 8571 8572 8573 8574 8575 8576 8577 8578 8579 8580 8581 8582 8583 8584 8585 8586 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8678 8679 8680 8681 8682 8683 8684 8685 8686 8687 8688 8689 8690 8691 8692 8693 8694 8695 8696 8697 8698 8699 8700 8701 8702 8703 8704 8705 8706 8707 8708 8709 8710 8711 8712 8713 8714 8715 8716 8717 8718 8719 8720 8721 8722 8723 8724 8725 8726 8727 8728 8729 8730 8731 8732 8733 8734 8735 8736 8737 8738 8739 8740 8741 8742 8743 8744 8745 8746 8747 8748 8749 8750 8751 8752 8753 8754 8755 8756 8757 8758 8759 8760 8761 8762 8763 8764 8765 8766 8767 8768 8769 8770 8771 8772 8773 8774 8775 8776 8777 8778 8779 8780 8781 8782 8783 8784 8785 8786 8787 8788 8789 8790 8791 8792 8793 8794 8795 8796 8797 8798 8799 8800 8801 8802 8803 8804 8805 8806 8807 8808 8809 8810 8811 8812 8813 8814 8815 8816 8817 8818 8819 8820 8821 8822 8823 8824 8825 8826 8827 8828 8829 8830 8831 8832 8833 8834 8835 8836 8837 8838 8839 8840 8841 8842 8843 8844 8845 8846 8847 8848 8849 8850 8851 8852 8853 8854 8855 8856 8857 8858 8859 8860 8861 8862 8863 8864 8865 8866 8867 8868 8869 8870 8871 8872 8873 8874 8875 8876 8877 8878 8879 8880 8881 8882 8883 8884 8885 8886 8887 8888 8889 8890 8891 8892 8893 8894 8895 8896 8897 8898 8899 8900 8901 8902 8903 8904 8905 8906 8907 8908 8909 8910 8911 8912 8913 8914 8915 8916 8917 8918 8919 8920 8921 8922 8923 8924 8925 8926 8927 8928 8929 8930 8931 8932 8933 8934 8935 8936 8937 8938 8939 8940 8941 8942 8943 8944 8945 8946 8947 8948 8949 8950 8951 8952 8953 8954 8955 8956 8957 8958 8959 8960 8961 8962 8963 8964 8965 8966 8967 8968 8969 8970 8971 8972 8973 8974 8975 8976 8977 8978 8979 8980 8981 8982 8983 8984 8985 8986 8987 8988 8989 8990 8991 8992 8993 8994 8995 8996 8997 8998 8999 9000 9001 9002 9003 9004 9005 9006 9007 9008 9009 9010 9011 9012 9013 9014 9015 9016 9017 9018 9019 9020 9021 9022 9023 9024 9025 9026 9027 9028 9029 9030 9031 9032 9033 9034 9035 9036 9037 9038 9039 9040 9041 9042 9043 9044 9045 9046 9047 9048 9049 9050 9051 9052 9053 9054 9055 9056 9057 9058 9059 9060 9061 9062 9063 9064 9065 9066 9067 9068 9069 9070 9071 9072 9073 9074 9075 9076 9077 9078 9079 9080 9081 9082 9083 9084 9085 9086 9087 9088 9089 9090 9091 9092 9093 9094 9095 9096 9097 9098 9099 9100 9101 9102 9103 9104 9105 9106 9107 9108 9109 9110 9111 9112 9113 9114 9115 9116 9117 9118 9119 9120 9121 9122 9123 9124 9125 9126 9127 9128 9129 9130 9131 9132 9133 9134 9135 9136 9137 9138 9139 9140 9141 9142 9143 9144 9145 9146 9147 9148 9149 9150 9151 9152 9153 9154 9155 9156 9157 9158 9159 9160 9161 9162 9163 9164 9165 9166 9167 9168 9169 9170 9171 9172 9173 9174 9175 9176 9177 9178 9179 9180 9181 9182 9183 9184 9185 9186 9187 9188 9189 9190 9191 9192 9193 9194 9195 9196 9197 9198 9199 9200 9201 9202 9203 9204 9205 9206 9207 9208 9209 9210 9211 9212 9213 9214 9215 9216 9217 9218 9219 9220 9221 9222 9223 9224 9225 9226 9227 9228 9229 9230 9231 9232 9233 9234 9235 9236 9237 9238 9239 9240 9241 9242 9243 9244 9245 9246 9247 9248 9249 9250 9251 9252 9253 9254 9255 9256 9257 9258 9259 9260 9261 9262 9263 9264 9265 9266 9267 9268 9269 9270 9271 9272 9273 9274 9275 9276 9277 9278 9279 9280 9281 9282 9283 9284 9285 9286 9287 9288 9289 9290 9291 9292 9293 9294 9295 9296 9297 9298 9299 9300 9301 9302 9303 9304 9305 9306 9307 9308 9309 9310 9311 9312 9313 9314 9315 9316 9317 9318 9319 9320 9321 9322 9323 9324 9325 9326 9327 9328 9329 9330 9331 9332 9333 9334 9335 9336 9337 9338 9339 9340 9341 9342 9343 9344 9345 9346 9347 9348 9349 9350 9351 9352 9353 9354 9355 9356 9357 9358 9359 9360 9361 9362 9363 9364 9365 9366 9367 9368 9369 9370 9371 9372 9373 9374 9375 9376 9377 9378 9379 9380 9381 9382 9383 9384 9385 9386 9387 9388 9389 9390 9391 9392 9393 9394 9395 9396 9397 9398 9399 9400 9401 9402 9403 9404 9405 9406 9407 9408 9409 9410 9411 9412 9413 9414 9415 9416 9417 9418 9419 9420 9421 9422 9423 9424 9425 9426 9427 9428 9429 9430 9431 9432 9433 9434 9435 9436 9437 9438 9439 9440 9441 9442 9443 9444 9445 9446 9447 9448 9449 9450 9451 9452 9453 9454 9455 9456 9457 9458 9459 9460 9461 9462 9463 9464 9465 9466 9467 9468 9469 9470 9471 9472 9473 9474 9475 9476 9477 9478 9479 9480 9481 9482 9483 9484 9485 9486 9487 9488 9489 9490 9491 9492 9493 9494 9495 9496 9497 9498 9499 9500 9501 9502 9503 9504 9505 9506 9507 9508 9509 9510 9511 9512 9513 9514 9515 9516 9517 9518 9519 9520 9521 9522 9523 9524 9525 9526 9527 9528 9529 9530 9531 9532 9533 9534 9535 9536 9537 9538 9539 9540 9541 9542 9543 9544 9545 9546 9547 9548 9549 9550 9551 9552 9553 9554 9555 9556 9557 9558 9559 9560 9561 9562 9563 9564 9565 9566 9567 9568 9569 9570 9571 9572 9573 9574 9575 9576 9577 9578 9579 9580 9581 9582 9583 9584 9585 9586 9587 9588 9589 9590 9591 9592 9593 9594 9595 9596 9597 9598 9599 9600 9601 9602 9603 9604 9605 9606 9607 9608 9609 9610 9611 9612 9613 9614 9615 9616 9617 9618 9619 9620 9621 9622 9623 9624 9625 9626 9627 9628 9629 9630 9631 9632 9633 9634 9635 9636 9637 9638 9639 9640 9641 9642 9643 9644 9645 9646 9647 9648 9649 9650 9651 9652 9653 9654 9655 9656 9657 9658 9659 9660 9661 9662 9663 9664 9665 9666 9667 9668 9669 9670 9671 9672 9673 9674 9675 9676 9677 9678 9679 9680 9681 9682 9683 9684 9685 9686 9687 9688 9689 9690 9691 9692 9693 9694 9695 9696 9697 9698 9699 9700 9701 9702 9703 9704 9705 9706 9707 9708 9709 9710 9711 9712 9713 9714 9715 9716 9717 9718 9719 9720 9721 9722 9723 9724 9725 9726 9727 9728 9729 9730 9731 9732 9733 9734 9735 9736 9737 9738 9739 9740 9741 9742 9743 9744 9745 9746 9747 9748 9749 9750 9751 9752 9753 9754 9755 9756 9757 9758 9759 9760 9761 9762 9763 9764 9765 9766 9767 9768 9769 9770 9771 9772 9773 9774 9775 9776 9777 9778 9779 9780 9781 9782 9783 9784 9785 9786 9787 9788 9789 9790 9791 9792 9793 9794 9795 9796 9797 9798 9799 9800 9801 9802 9803 9804 9805 9806 9807 9808 9809 9810 9811 9812 9813 9814 9815 9816 9817 9818 9819 9820 9821 9822 9823 9824 9825 9826 9827 9828 9829 9830 9831 9832 9833 9834 9835 9836 9837 9838 9839 9840 9841 9842 9843 9844 9845 9846 9847 9848 9849 9850 9851 9852 9853 9854 9855 9856 9857 9858 9859 9860 9861 9862 9863 9864 9865 9866 9867 9868 9869 9870 9871 9872 9873 9874 9875 9876 9877 9878 9879 9880 9881 9882 9883 9884 9885 9886 9887 9888 9889 9890 9891 9892 9893 9894 9895 9896 9897 9898 9899 9900 9901 9902 9903 9904 9905 9906 9907 9908 9909 9910 9911 9912 9913 9914 9915 9916 9917 9918 9919 9920 9921 9922 9923 9924 9925 9926 9927 9928 9929 9930 9931 9932 9933 9934 9935 9936 9937 9938 9939 9940 9941 9942 9943 9944 9945 9946 9947 9948 9949 9950 9951 9952 9953 9954 9955 9956 9957 9958 9959 9960 9961 9962 9963 9964 9965 9966 9967 9968 9969 9970 9971 9972 9973 9974 9975 9976 9977 9978 9979 9980 9981 9982 9983 9984 9985 9986 9987 9988 9989 9990 9991 9992 9993 9994 9995 9996 9997 9998 9999 10000 10001 10002 10003 10004 10005 10006 10007 10008 10009 10010 10011 10012 10013 10014 10015 10016 10017 10018 10019 10020 10021 10022 10023 10024 10025 10026 10027 10028 10029 10030 10031 10032 10033 10034 10035 10036 10037 10038 10039 10040 10041 10042 10043 10044 10045 10046 10047 10048 10049 10050 10051 10052 10053 10054 10055 10056 10057 10058 10059 10060 10061 10062 10063 10064 10065 10066 10067 10068 10069 10070 10071 10072 10073 10074 10075 10076 10077 10078 10079 10080 10081 10082 10083 10084 10085 10086 10087 10088 10089 10090 10091 10092 10093 10094 10095 10096 10097 10098 10099 10100 10101 10102 10103 10104 10105 10106 10107 10108 10109 10110 10111 10112 10113 10114 10115 10116 10117 10118 10119 10120 10121 10122 10123 10124 10125 10126 10127 10128 10129 10130 10131 10132 10133 10134 10135 10136 10137 10138 10139 10140 10141 10142 10143 10144 10145 10146 10147 10148 10149 10150 10151 10152 10153 10154 10155 10156 10157 10158 10159 10160 10161 10162 10163 10164 10165 10166 10167 10168 10169 10170 10171 10172 10173 10174 10175 10176 10177 10178 10179 10180 10181 10182 10183 10184 10185 10186 10187 10188 10189 10190 10191 10192 10193 10194 10195 10196 10197 10198 10199 10200 10201 10202 10203 10204 10205 10206 10207 10208 10209 10210 10211 10212 10213 10214 10215 10216 10217 10218 10219 10220 10221 10222 10223 10224 10225 10226 10227 10228 10229 10230 10231 10232 10233 10234 10235 10236 10237 10238 10239 10240 10241 10242 10243 10244 10245 10246 10247 10248 10249 10250 10251 10252 10253 10254 10255 10256 10257 10258 10259 10260 10261 10262 10263 10264 10265 10266 10267 10268 10269 10270 10271 10272 10273 10274 10275 10276 10277 10278 10279 10280 10281 10282 10283 10284 10285 10286 10287 10288 10289 10290 10291 10292 10293 10294 10295 10296 10297 10298 10299 10300 10301 10302 10303 10304 10305 10306 10307 10308 10309 10310 10311 10312 10313 10314 10315 10316 10317 10318 10319 10320 10321 10322 10323 10324 10325 10326 10327 10328 10329 10330 10331 10332 10333 10334 10335 10336 10337 10338 10339 10340 10341 10342 10343 10344 10345 10346 10347 10348 10349 10350 10351 10352 10353 10354 10355 10356 10357 10358 10359 10360 10361 10362 10363 10364 10365 10366 10367 10368 10369 10370 10371 10372 10373 10374 10375 10376 10377 10378 10379 10380 10381 10382 10383 10384 10385 10386 10387 10388 10389 10390 10391 10392 10393 10394 10395 10396 10397 10398 10399 10400 10401 10402 10403 10404 10405 10406 10407 10408 10409 10410 10411 10412 10413 10414 10415 10416 10417 10418 10419 10420 10421 10422 10423 10424 10425 10426 10427 10428 10429 10430 10431 10432 10433 10434 10435 10436 10437 10438 10439 10440 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466 10467 10468 10469 10470 10471 10472 10473 10474 10475 10476 10477 10478 10479 10480 10481 10482 10483 10484 10485 10486 10487 10488 10489 10490 10491 10492 10493 10494 10495 10496 10497 10498 10499 10500 10501 10502 10503 10504 10505 10506 10507 10508 10509 10510 10511 10512 10513 10514 10515 10516 10517 10518 10519 10520 10521 10522 10523 10524 10525 10526 10527 10528 10529 10530 10531 10532 10533 10534 10535 10536 10537 10538 10539 10540 10541 10542 10543 10544 10545 10546 10547 10548 10549 10550 10551 10552 10553 10554 10555 10556 10557 10558 10559 10560 10561 10562 10563 10564 10565 10566 10567 10568 10569 10570 10571 10572 10573 10574 10575 10576 10577 10578 10579 10580 10581 10582 10583 10584 10585 10586 10587 10588 10589 10590 10591 10592 10593 10594 10595 10596 10597 10598 10599 10600 10601 10602 10603 10604 10605 10606 10607 10608 10609 10610 10611 10612 10613 10614 10615 10616 10617 10618 10619 10620 10621 10622 10623 10624 10625 10626 10627 10628 10629 10630 10631 10632 10633 10634 10635 10636 10637 10638 10639 10640 10641 10642 10643 10644 10645 10646 10647 10648 10649 10650 10651 10652 10653 10654 10655 10656 10657 10658 10659 10660 10661 10662 10663 10664 10665 10666 10667 10668 10669 10670 10671 10672 10673 10674 10675 10676 10677 10678 10679 10680 10681 10682 10683 10684 10685 10686 10687 10688 10689 10690 10691 10692 10693 10694 10695 10696 10697 10698 10699 10700 10701 10702 10703 10704 10705 10706 10707 10708 10709 10710 10711 10712 10713 10714 10715 10716 10717 10718 10719 10720 10721 10722 10723 10724 10725 10726 10727 10728 10729 10730 10731 10732 10733 10734 10735 10736 10737 10738 10739 10740 10741 10742 10743 10744 10745 10746 10747 10748 10749 10750 10751 10752 10753 10754 10755 10756 10757 10758 10759 10760 10761 10762 10763 10764 10765 10766 10767 10768 10769 10770 10771 10772 10773 10774 10775 10776 10777 10778 10779 10780 10781 10782 10783 10784 10785 10786 10787 10788 10789 10790 10791 10792 10793 10794 10795 10796 10797 10798 10799 10800 10801 10802 10803 10804 10805 10806 10807 10808 10809 10810 10811 10812 10813 10814 10815 10816 10817 10818 10819 10820 10821 10822 10823 10824 10825 10826 10827 10828 10829 10830 10831 10832 10833 10834 10835 10836 10837 10838 10839 10840 10841 10842 10843 10844 10845 10846 10847 10848 10849 10850 10851 10852 10853 10854 10855 10856 10857 10858 10859 10860 10861 10862 10863 10864 10865 10866 10867 10868 10869 10870 10871 10872 10873 10874 10875 10876 10877 10878 10879 10880 10881 10882 10883 10884 10885 10886 10887 10888 10889 10890 10891 10892 10893 10894 10895 10896 10897 10898 10899 10900 10901 10902 10903 10904 10905 10906 10907 10908 10909 10910 10911 10912 10913 10914 10915 10916 10917 10918 10919 10920 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 10967 10968 10969 10970 10971 10972 10973 10974 10975 10976 10977 10978 10979 10980 10981 10982 10983 10984 10985 10986 10987 10988 10989 10990 10991 10992 10993 10994 10995 10996 10997 10998 10999 11000 11001 11002 11003 11004 11005 11006 11007 11008 11009 11010 11011 11012 11013 11014 11015 11016 11017 11018 11019 11020 11021 11022 11023 11024 11025 11026 11027 11028 11029 11030 11031 11032 11033 11034 11035 11036 11037 11038 11039 11040 11041 11042 11043 11044 11045 11046 11047 11048 11049 11050 11051 11052 11053 11054 11055 11056 11057 11058 11059 11060 11061 11062 11063 11064 11065 11066 11067 11068 11069 11070 11071 11072 11073 11074 11075 11076 11077 11078 11079 11080 11081 11082 11083 11084 11085 11086 11087 11088 11089 11090 11091 11092 11093 11094 11095 11096 11097 11098 11099 11100 11101 11102 11103 11104 11105 11106 11107 11108 11109 11110 11111 11112 11113 11114 11115 11116 11117 11118 11119 11120 11121 11122 11123 11124 11125 11126 11127 11128 11129 11130 11131 11132 11133 11134 11135 11136 11137 11138 11139 11140 11141 11142 11143 11144 11145 11146 11147 11148 11149 11150 11151 11152 11153 11154 11155 11156 11157 11158 11159 11160 11161 11162 11163 11164 11165 11166 11167 11168 11169 11170 11171 11172 11173 11174 11175 11176 11177 11178 11179 11180 11181 11182 11183 11184 11185 11186 11187 11188 11189 11190 11191 11192 11193 11194 11195 11196 11197 11198 11199 11200 11201 11202 11203 11204 11205 11206 11207 11208 11209 11210 11211 11212 11213 11214 11215 11216 11217 11218 11219 11220 11221 11222 11223 11224 11225 11226 11227 11228 11229 11230 11231 11232 11233 11234 11235 11236 11237 11238 11239 11240 11241 11242 11243 11244 11245 11246 11247 11248 11249 11250 11251 11252 11253 11254 11255 11256 11257 11258 11259 11260 11261 11262 11263 11264 11265 11266 11267 11268 11269 11270 11271 11272 11273 11274 11275 11276 11277 11278 11279 11280 11281 11282 11283 11284 11285 11286 11287 11288 11289 11290 11291 11292 11293 11294 11295 11296 11297 11298 11299 11300 11301 11302 11303 11304 11305 11306 11307 11308 11309 11310 11311 11312 11313 11314 11315 11316 11317 11318 11319 11320 11321 11322 11323 11324 11325 11326 11327 11328 11329 11330 11331 11332 11333 11334 11335 11336 11337 11338 11339 11340 11341 11342 11343 11344 11345 11346 11347 11348 11349 11350 11351 11352 11353 11354 11355 11356 11357 11358 11359 11360 11361 11362 11363 11364 11365 11366 11367 11368 11369 11370 11371 11372 11373 11374 11375 11376 11377 11378 11379 11380 11381 11382 11383 11384 11385 11386 11387 11388 11389 11390 11391 11392 11393 11394 11395 11396 11397 11398 11399 11400 11401 11402 11403 11404 11405 11406 11407 11408 11409 11410 11411 11412 11413 11414 11415 11416 11417 11418 11419 11420 11421 11422 11423 11424 11425 11426 11427 11428 11429 11430 11431 11432 11433 11434 11435 11436 11437 11438 11439 11440 11441 11442 11443 11444 11445 11446 11447 11448 11449 11450 11451 11452 11453 11454 11455 11456 11457 11458 11459 11460 11461 11462 11463 11464 11465 11466 11467 11468 11469 11470 11471 11472 11473 11474 11475 11476 11477 11478 11479 11480 11481 11482 11483 11484 11485 11486 11487 11488 11489 11490 11491 11492 11493 11494 11495 11496 11497 11498 11499 11500 11501 11502 11503 11504 11505 11506 11507 11508 11509 11510 11511 11512 11513 11514 11515 11516 11517 11518 11519 11520 11521 11522 11523 11524 11525 11526 11527 11528 11529 11530 11531 11532 11533 11534 11535 11536 11537 11538 11539 11540 11541 11542 11543 11544 11545 11546 11547 11548 11549 11550 11551 11552 11553 11554 11555 11556 11557 11558 11559 11560 11561 11562 11563 11564 11565 11566 11567 11568 11569 11570 11571 11572 11573 11574 11575 11576 11577 11578 11579 11580 11581 11582 11583 11584 11585 11586 11587 11588 11589 11590 11591 11592 11593 11594 11595 11596 11597 11598 11599 11600 11601 11602 11603 11604 11605 11606 11607 11608 11609 11610 11611 11612 11613 11614 11615 11616 11617 11618 11619 11620 11621 11622 11623 11624 11625 11626 11627 11628 11629 11630 11631 11632 11633 11634 11635 11636 11637 11638 11639 11640 11641 11642 11643 11644 11645 11646 11647 11648 11649 11650 11651 11652 11653 11654 11655 11656 11657 11658 11659 11660 11661 11662 11663 11664 11665 11666 11667 11668 11669 11670 11671 11672 11673 11674 11675 11676 11677 11678 11679 11680 11681 11682 11683 11684 11685 11686 11687 11688 11689 11690 11691 11692 11693 11694 11695 11696 11697 11698 11699 11700 11701 11702 11703 11704 11705 11706 11707 11708 11709 11710 11711 11712 11713 11714 11715 11716 11717 11718 11719 11720 11721 11722 11723 11724 11725 11726 11727 11728 11729 11730 11731 11732 11733 11734 11735 11736 11737 11738 11739 11740 11741 11742 11743 11744 11745 11746 11747 11748 11749 11750 11751 11752 11753 11754 11755 11756 11757 11758 11759 11760 11761 11762 11763 11764 11765 11766 11767 11768 11769 11770 11771 11772 11773 11774 11775 11776 11777 11778 11779 11780 11781 11782 11783 11784 11785 11786 11787 11788 11789 11790 11791 11792 11793 11794 11795 11796 11797 11798 11799 11800 11801 11802 11803 11804 11805 11806 11807 11808 11809 11810 11811 11812 11813 11814 11815 11816 11817 11818 11819 11820 11821 11822 11823 11824 11825 11826 11827 11828 11829 11830 11831 11832 11833 11834 11835 11836 11837 11838 11839 11840 11841 11842 11843 11844 11845 11846 11847 11848 11849 11850 11851 11852 11853 11854 11855 11856 11857 11858 11859 11860 11861 11862 11863 11864 11865 11866 11867 11868 11869 11870 11871 11872 11873 11874 11875 11876 11877 11878 11879 11880 11881 11882 11883 11884 11885 11886 11887 11888 11889 11890 11891 11892 11893 11894 11895 11896 11897 11898 11899 11900 11901 11902 11903 11904 11905 11906 11907 11908 11909 11910 11911 11912 11913 11914 11915 11916 11917 11918 11919 11920 11921 11922 11923 11924 11925 11926 11927 11928 11929 11930 11931 11932 11933 11934 11935 11936 11937 11938 11939 11940 11941 11942 11943 11944 11945 11946 11947 11948 11949 11950 11951 11952 11953 11954 11955 11956 11957 11958 11959 11960 11961 11962 11963 11964 11965 11966 11967 11968 11969 11970 11971 11972 11973 11974 11975 11976 11977 11978 11979 11980 11981 11982 11983 11984 11985 11986 11987 11988 11989 11990 11991 11992 11993 11994 11995 11996 11997 11998 11999 12000 12001 12002 12003 12004 12005 12006 12007 12008 12009 12010 12011 12012 12013 12014 12015 12016 12017 12018 12019 12020 12021 12022 12023 12024 12025 12026 12027 12028 12029 12030 12031 12032 12033 12034 12035 12036 12037 12038 12039 12040 12041 12042 12043 12044 12045 12046 12047 12048 12049 12050 12051 12052 12053 12054 12055 12056 12057 12058 12059 12060 12061 12062 12063 12064 12065 12066 12067 12068 12069 12070 12071 12072 12073 12074 12075 12076 12077 12078 12079 12080 12081 12082 12083 12084 12085 12086 12087 12088 12089 12090 12091 12092 12093 12094 12095 12096 12097 12098 12099 12100 12101 12102 12103 12104 12105 12106 12107 12108 12109 12110 12111 12112 12113 12114 12115 12116 12117 12118 12119 12120 12121 12122 12123 12124 12125 12126 12127 12128 12129 12130 12131 12132 12133 12134 12135 12136 12137 12138 12139 12140 12141 12142 12143 12144 12145 12146 12147 12148 12149 12150 12151 12152 12153 12154 12155 12156 12157 12158 12159 12160 12161 12162 12163 12164 12165 12166 12167 12168 12169 12170 12171 12172 12173 12174 12175 12176 12177 12178 12179 12180 12181 12182 12183 12184 12185 12186 12187 12188 12189 12190 12191 12192 12193 12194 12195 12196 12197 12198 12199 12200 12201 12202 12203 12204 12205 12206 12207 12208 12209 12210 12211 12212 12213 12214 12215 12216 12217 12218 12219 12220 12221 12222 12223 12224 12225 12226 12227 12228 12229 12230 12231 12232 12233 12234 12235 12236 12237 12238 12239 12240 12241 12242 12243 12244 12245 12246 12247 12248 12249 12250 12251 12252 12253 12254 12255 12256 12257 12258 12259 12260 12261 12262 12263 12264 12265 12266 12267 12268 12269 12270 12271 12272 12273 12274 12275 12276 12277 12278 12279 12280 12281 12282 12283 12284 12285 12286 12287 12288 12289 12290 12291 12292 12293 12294 12295 12296 12297 12298 12299 12300 12301 12302 12303 12304 12305 12306 12307 12308 12309 12310 12311 12312 12313 12314 12315 12316 12317 12318 12319 12320 12321 12322 12323 12324 12325 12326 12327 12328 12329 12330 12331 12332 12333 12334 12335 12336 12337 12338 12339 12340 12341 12342 12343 12344 12345 12346 12347 12348 12349 12350 12351 12352 12353 12354 12355 12356 12357 12358 12359 12360 12361 12362 12363 12364 12365 12366 12367 12368 12369 12370 12371 12372 12373 12374 12375 12376 12377 12378 12379 12380 12381 12382 12383 12384 12385 12386 12387 12388 12389 12390 12391 12392 12393 12394 12395 12396 12397 12398 12399 12400 12401 12402 12403 12404 12405 12406 12407 12408 12409 12410 12411 12412 12413 12414 12415 12416 12417 12418 12419 12420 12421 12422 12423 12424 12425 12426 12427 12428 12429 12430 12431 12432 12433 12434 12435 12436 12437 12438 12439 12440 12441 12442 12443 12444 12445 12446 12447 12448 12449 12450 12451 12452 12453 12454 12455 12456 12457 12458 12459 12460 12461 12462 12463 12464 12465 12466 12467 12468 12469 12470 12471 12472 12473 12474 12475 12476 12477 12478 12479 12480 12481 12482 12483 12484 12485 12486 12487 12488 12489 12490 12491 12492 12493 12494 12495 12496 12497 12498 12499 12500 12501 12502 12503 12504 12505 12506 12507 12508 12509 12510 12511 12512 12513 12514 12515 12516 12517 12518 12519 12520 12521 12522 12523 12524 12525 12526 12527 12528 12529 12530 12531 12532 12533 12534 12535 12536 12537 12538 12539 12540 12541 12542 12543 12544 12545 12546 12547 12548 12549 12550 12551 12552 12553 12554 12555 12556 12557 12558 12559 12560 12561 12562 12563 12564 12565 12566 12567 12568 12569 12570 12571 12572 12573 12574 12575 12576 12577 12578 12579 12580 12581 12582 12583 12584 12585 12586 12587 12588 12589 12590 12591 12592 12593 12594 12595 12596 12597 12598 12599 12600 12601 12602 12603 12604 12605 12606 12607 12608 12609 12610 12611 12612 12613 12614 12615 12616 12617 12618 12619 12620 12621 12622 12623 12624 12625 12626 12627 12628 12629 12630 12631 12632 12633 12634 12635 12636 12637 12638 12639 12640 12641 12642 12643 12644 12645 12646 12647 12648 12649 12650 12651 12652 12653 12654 12655 12656 12657 12658 12659 12660 12661 12662 12663 12664 12665 12666 12667 12668 12669 12670 12671 12672 12673 12674 12675 12676 12677 12678 12679 12680 12681 12682 12683 12684 12685 12686 12687 12688 12689 12690 12691 12692 12693 12694 12695 12696 12697 12698 12699 12700 12701 12702 12703 12704 12705 12706 12707 12708 12709 12710 12711 12712 12713 12714 12715 12716 12717 12718 12719 12720 12721 12722 12723 12724 12725 12726 12727 12728 12729 12730 12731 12732 12733 12734 12735 12736 12737 12738 12739 12740 12741 12742 12743 12744 12745 12746 12747 12748 12749 12750 12751 12752 12753 12754 12755 12756 12757 12758 12759 12760 12761 12762 12763 12764 12765 12766 12767 12768 12769 12770 12771 12772 12773 12774 12775 12776 12777 12778 12779 12780 12781 12782 12783 12784 12785 12786 12787 12788 12789 12790 12791 12792 12793 12794 12795 12796 12797 12798 12799 12800 12801 12802 12803 12804 12805 12806 12807 12808 12809 12810 12811 12812 12813 12814 12815 12816 12817 12818 12819 12820 12821 12822 12823 12824 12825 12826 12827 12828 12829 12830 12831 12832 12833 12834 12835 12836 12837 12838 12839 12840 12841 12842 12843 12844 12845 12846 12847 12848 12849 12850 12851 12852 12853 12854 12855 12856 12857 12858 12859 12860 12861 12862 12863 12864 12865 12866 12867 12868 12869 12870 12871 12872 12873 12874 12875 12876 12877 12878 12879 12880 12881 12882 12883 12884 12885 12886 12887 12888 12889 12890 12891 12892 12893 12894 12895 12896 12897 12898 12899 12900 12901 12902 12903 12904 12905 12906 12907 12908 12909 12910 12911 12912 12913 12914 12915 12916 12917 12918 12919 12920 12921 12922 12923 12924 12925 12926 12927 12928 12929 12930 12931 12932 12933 12934 12935 12936 12937 12938 12939 12940 12941 12942 12943 12944 12945 12946 12947 12948 12949 12950 12951 12952 12953 12954 12955 12956 12957 12958 12959 12960 12961 12962 12963 12964 12965 12966 12967 12968 12969 12970 12971 12972 12973 12974 12975 12976 12977 12978 12979 12980 12981 12982 12983 12984 12985 12986 12987 12988 12989 12990 12991 12992 12993 12994 12995 12996 12997 12998 12999 13000 13001 13002 13003 13004 13005 13006 13007 13008 13009 13010 13011 13012 13013 13014 13015 13016 13017 13018 13019 13020 13021 13022 13023 13024 13025 13026 13027 13028 13029 13030 13031 13032 13033 13034 13035 13036 13037 13038 13039 13040 13041 13042 13043 13044 13045 13046 13047 13048 13049 13050 13051 13052 13053 13054 13055 13056 13057 13058 13059 13060 13061 13062 13063 13064 13065 13066 13067 13068 13069 13070 13071 13072 13073 13074 13075 13076 13077 13078 13079 13080 13081 13082 13083 13084 13085 13086 13087 13088 13089 13090 13091 13092 13093 13094 13095 13096 13097 13098 13099 13100 13101 13102 13103 13104 13105 13106 13107 13108 13109 13110 13111 13112 13113 13114 13115 13116 13117 13118 13119 13120 13121 13122 13123 13124 13125 13126 13127 13128 13129 13130 13131 13132 13133 13134 13135 13136 13137 13138 13139 13140 13141 13142 13143 13144 13145 13146 13147 13148 13149 13150 13151 13152 13153 13154 13155 13156 13157 13158 13159 13160 13161 13162 13163 13164 13165 13166 13167 13168 13169 13170 13171 13172 13173 13174 13175 13176 13177 13178 13179 13180 13181 13182 13183 13184 13185 13186 13187 13188 13189 13190 13191 13192 13193 13194 13195 13196 13197 13198 13199 13200 13201 13202 13203 13204 13205 13206 13207 13208 13209 13210 13211 13212 13213 13214 13215 13216 13217 13218 13219 13220 13221 13222 13223 13224 13225 13226 13227 13228 13229 13230 13231 13232 13233 13234 13235 13236 13237 13238 13239 13240 13241 13242 13243 13244 13245 13246 13247 13248 13249 13250 13251 13252 13253 13254 13255 13256 13257 13258 13259 13260 13261 13262 13263 13264 13265 13266 13267 13268 13269 13270 13271 13272 13273 13274 13275 13276 13277 13278 13279 13280 13281 13282 13283 13284 13285 13286 13287 13288 13289 13290 13291 13292 13293 13294 13295 13296 13297 13298 13299 13300 13301 13302 13303 13304 13305 13306 13307 13308 13309 13310 13311 13312 13313 13314 13315 13316 13317 13318 13319 13320 13321 13322 13323 13324 13325 13326 13327 13328 13329 13330 13331 13332 13333 13334 13335 13336 13337 13338 13339 13340 13341 13342 13343 13344 13345 13346 13347 13348 13349 13350 13351 13352 13353 13354 13355 13356 13357 13358 13359 13360 13361 13362 13363 13364 13365 13366 13367 13368 13369 13370 13371 13372 13373 13374 13375 13376 13377 13378 13379 13380 13381 13382 13383 13384 13385 13386 13387 13388 13389 13390 13391 13392 13393 13394 13395 13396 13397 13398 13399 13400 13401 13402 13403 13404 13405 13406 13407 13408 13409 13410 13411 13412 13413 13414 13415 13416 13417 13418 13419 13420 13421 13422 13423 13424 13425 13426 13427 13428 13429 13430 13431 13432 13433 13434 13435 13436 13437 13438 13439 13440 13441 13442 13443 13444 13445 13446 13447 13448 13449 13450 13451 13452 13453 13454 13455 13456 13457 13458 13459 13460 13461 13462 13463 13464 13465 13466 13467 13468 13469 13470 13471 13472 13473 13474 13475 13476 13477 13478 13479 13480 13481 13482 13483 13484 13485 13486 13487 13488 13489 13490 13491 13492 13493 13494 13495 13496 13497 13498 13499 13500 13501 13502 13503 13504 13505 13506 13507 13508 13509 13510 13511 13512 13513 13514 13515 13516 13517 13518 13519 13520 13521 13522 13523 13524 13525 13526 13527 13528 13529 13530 13531 13532 13533 13534 13535 13536 13537 13538 13539 13540 13541 13542 13543 13544 13545 13546 13547 13548 13549 13550 13551 13552 13553 13554 13555 13556 13557 13558 13559 13560 13561 13562 13563 13564 13565 13566 13567 13568 13569 13570 13571 13572 13573 13574 13575 13576 13577 13578 13579 13580 13581 13582 13583 13584 13585 13586 13587 13588 13589 13590 13591 13592 13593 13594 13595 13596 13597 13598 13599 13600 13601 13602 13603 13604 13605 13606 13607 13608 13609 13610 13611 13612 13613 13614 13615 13616 13617 13618 13619 13620 13621 13622 13623 13624 13625 13626 13627 13628 13629 13630 13631 13632 13633 13634 13635 13636 13637 13638 13639 13640 13641 13642 13643 13644 13645 13646 13647 13648 13649 13650 13651 13652 13653 13654 13655 13656 13657 13658 13659 13660 13661 13662 13663 13664 13665 13666 13667 13668 13669 13670 13671 13672 13673 13674 13675 13676 13677 13678 13679 13680 13681 13682 13683 13684 13685 13686 13687 13688 13689 13690 13691 13692 13693 13694 13695 13696 13697 13698 13699 13700 13701 13702 13703 13704 13705 13706 13707 13708 13709 13710 13711 13712 13713 13714 13715 13716 13717 13718 13719 13720 13721 13722 13723 13724 13725 13726 13727 13728 13729 13730 13731 13732 13733 13734 13735 13736 13737 13738 13739 13740 13741 13742 13743 13744 13745 13746 13747 13748 13749 13750 13751 13752 13753 13754 13755 13756 13757 13758 13759 13760 13761 13762 13763 13764 13765 13766 13767 13768 13769 13770 13771 13772 13773 13774 13775 13776 13777 13778 13779 13780 13781 13782 13783 13784 13785 13786 13787 13788 13789 13790 13791 13792 13793 13794 13795 13796 13797 13798 13799 13800 13801 13802 13803 13804 13805 13806 13807 13808 13809 13810 13811 13812 13813 13814 13815 13816 13817 13818 13819 13820 13821 13822 13823 13824 13825 13826 13827 13828 13829 13830 13831 13832 13833 13834 13835 13836 13837 13838 13839 13840 13841 13842 13843 13844 13845 13846 13847 13848 13849 13850 13851 13852 13853 13854 13855 13856 13857 13858 13859 13860 13861 13862 13863 13864 13865 13866 13867 13868 13869 13870 13871 13872 13873 13874 13875 13876 13877 13878 13879 13880 13881 13882 13883 13884 13885 13886 13887 13888 13889 13890 13891 13892 13893 13894 13895 13896 13897 13898 13899 13900 13901 13902 13903 13904 13905 13906 13907 13908 13909 13910 13911 13912 13913 13914 13915 13916 13917 13918 13919 13920 13921 13922 13923 13924 13925 13926 13927 13928 13929 13930 13931 13932 13933 13934 13935 13936 13937 13938 13939 13940 13941 13942 13943 13944 13945 13946 13947 13948 13949 13950 13951 13952 13953 13954 13955 13956 13957 13958 13959 13960 13961 13962 13963 13964 13965 13966 13967 13968 13969 13970 13971 13972 13973 13974 13975 13976 13977 13978 13979 13980 13981 13982 13983 13984 13985 13986 13987 13988 13989 13990 13991 13992 13993 13994 13995 13996 13997 13998 13999 14000 14001 14002 14003 14004 14005 14006 14007 14008 14009 14010 14011 14012 14013 14014 14015 14016 14017 14018 14019 14020 14021 14022 14023 14024 14025 14026 14027 14028 14029 14030 14031 14032 14033 14034 14035 14036 14037 14038 14039 14040 14041 14042 14043 14044 14045 14046 14047 14048 14049 14050 14051 14052 14053 14054 14055 14056 14057 14058 14059 14060 14061 14062 14063 14064 14065 14066 14067 14068 14069 14070 14071 14072 14073 14074 14075 14076 14077 14078 14079 14080 14081 14082 14083 14084 14085 14086 14087 14088 14089 14090 14091 14092 14093 14094 14095 14096 14097 14098 14099 14100 14101 14102 14103 14104 14105 14106 14107 14108 14109 14110 14111 14112 14113 14114 14115 14116 14117 14118 14119 14120 14121 14122 14123 14124 14125 14126 14127 14128 14129 14130 14131 14132 14133 14134 14135 14136 14137 14138 14139 14140 14141 14142 14143 14144 14145 14146 14147 14148 14149 14150 14151 14152 14153 14154 14155 14156 14157 14158 14159 14160 14161 14162 14163 14164 14165 14166 14167 14168 14169 14170 14171 14172 14173 14174 14175 14176 14177 14178 14179 14180 14181 14182 14183 14184 14185 14186 14187 14188 14189 14190 14191 14192 14193 14194 14195 14196 14197 14198 14199 14200 14201 14202 14203 14204 14205 14206 14207 14208 14209 14210 14211 14212 14213 14214 14215 14216 14217 14218 14219 14220 14221 14222 14223 14224 14225 14226 14227 14228 14229 14230 14231 14232 14233 14234 14235 14236 14237 14238 14239 14240 14241 14242 14243 14244 14245 14246 14247 14248 14249 14250 14251 14252 14253 14254 14255 14256 14257 14258 14259 14260 14261 14262 14263 14264 14265 14266 14267 14268 14269 14270 14271 14272 14273 14274 14275 14276 14277 14278 14279 14280 14281 14282 14283 14284 14285 14286 14287 14288 14289 14290 14291 14292 14293 14294 14295 14296 14297 14298 14299 14300 14301 14302 14303 14304 14305 14306 14307 14308 14309 14310 14311 14312 14313 14314 14315 14316 14317 14318 14319 14320 14321 14322 14323 14324 14325 14326 14327 14328 14329 14330 14331 14332 14333 14334 14335 14336 14337 14338 14339 14340 14341 14342 14343 14344 14345 14346 14347 14348 14349 14350 14351 14352 14353 14354 14355 14356 14357 14358 14359 14360 14361 14362 14363 14364 14365 14366 14367 14368 14369 14370 14371 14372 14373 14374 14375 14376 14377 14378 14379 14380 14381 14382 14383 14384 14385 14386 14387 14388 14389 14390 14391 14392 14393 14394 14395 14396 14397 14398 14399 14400 14401 14402 14403 14404 14405 14406 14407 14408 14409 14410 14411 14412 14413 14414 14415 14416 14417 14418 14419 14420 14421 14422 14423 14424 14425 14426 14427 14428 14429 14430 14431 14432 14433 14434 14435 14436 14437 14438 14439 14440 14441 14442 14443 14444 14445 14446 14447 14448 14449 14450 14451 14452 14453 14454 14455 14456 14457 14458 14459 14460 14461 14462 14463 14464 14465 14466 14467 14468 14469 14470 14471 14472 14473 14474 14475 14476 14477 14478 14479 14480 14481 14482 14483 14484 14485 14486 14487 14488 14489 14490 14491 14492 14493 14494 14495 14496 14497 14498 14499 14500 14501 14502 14503 14504 14505 14506 14507 14508 14509 14510 14511 14512 14513 14514 14515 14516 14517 14518 14519 14520 14521 14522 14523 14524 14525 14526 14527 14528 14529 14530 14531 14532 14533 14534 14535 14536 14537 14538 14539 14540 14541 14542 14543 14544 14545 14546 14547 14548 14549 14550 14551 14552 14553 14554 14555 14556 14557 14558 14559 14560 14561 14562 14563 14564 14565 14566 14567 14568 14569 14570 14571 14572 14573 14574 14575 14576 14577 14578 14579 14580 14581 14582 14583 14584 14585 14586 14587 14588 14589 14590 14591 14592 14593 14594 14595 14596 14597 14598 14599 14600 14601 14602 14603 14604 14605 14606 14607 14608 14609 14610 14611 14612 14613 14614 14615 14616 14617 14618 14619 14620 14621 14622 14623 14624 14625 14626 14627 14628 14629 14630 14631 14632 14633 14634 14635 14636 14637 14638 14639 14640 14641 14642 14643 14644 14645 14646 14647 14648 14649 14650 14651 14652 14653 14654 14655 14656 14657 14658 14659 14660 14661 14662 14663 14664 14665 14666 14667 14668 14669 14670 14671 14672 14673 14674 14675 14676 14677 14678 14679 14680 14681 14682 14683 14684 14685 14686 14687 14688 14689 14690 14691 14692 14693 14694 14695 14696 14697 14698 14699 14700 14701 14702 14703 14704 14705 14706 14707 14708 14709 14710 14711 14712 14713 14714 14715 14716 14717 14718 14719 14720 14721 14722 14723 14724 14725 14726 14727 14728 14729 14730 14731 14732 14733 14734 14735 14736 14737 14738 14739 14740 14741 14742 14743 14744 14745 14746 14747 14748 14749 14750 14751 14752 14753 14754 14755 14756 14757 14758 14759 14760 14761 14762 14763 14764 14765 14766 14767 14768 14769 14770 14771 14772 14773 14774 14775 14776 14777 14778 14779 14780 14781 14782 14783 14784 14785 14786 14787 14788 14789 14790 14791 14792 14793 14794 14795 14796 14797 14798 14799 14800 14801 14802 14803 14804 14805 14806 14807 14808 14809 14810 14811 14812 14813 14814 14815 14816 14817 14818 14819 14820 14821 14822 14823 14824 14825 14826 14827 14828 14829 14830 14831 14832 14833 14834 14835 14836 14837 14838 14839 14840 14841 14842 14843 14844 14845 14846 14847 14848 14849 14850 14851 14852 14853 14854 14855 14856 14857 14858 14859 14860 14861 14862 14863 14864 14865 14866 14867 14868 14869 14870 14871 14872 14873 14874 14875 14876 14877 14878 14879 14880 14881 14882 14883 14884 14885 14886 14887 14888 14889 14890 14891 14892 14893 14894 14895 14896 14897 14898 14899 14900 14901 14902 14903 14904 14905 14906 14907 14908 14909 14910 14911 14912 14913 14914 14915 14916 14917 14918 14919 14920 14921 14922 14923 14924 14925 14926 14927 14928 14929 14930 14931 14932 14933 14934 14935 14936 14937 14938 14939 14940 14941 14942 14943 14944 14945 14946 14947 14948 14949 14950 14951 14952 14953 14954 14955 14956 14957 14958 14959 14960 14961 14962 14963 14964 14965 14966 14967 14968 14969 14970 14971 14972 14973 14974 14975 14976 14977 14978 14979 14980 14981 14982 14983 14984 14985 14986 14987 14988 14989 14990 14991 14992 14993 14994 14995 14996 14997 14998 14999 15000 15001 15002 15003 15004 15005 15006 15007 15008 15009 15010 15011 15012 15013 15014 15015 15016 15017 15018 15019 15020 15021 15022 15023 15024 15025 15026 15027 15028 15029 15030 15031 15032 15033 15034 15035 15036 15037 15038 15039 15040 15041 15042 15043 15044 15045 15046 15047 15048 15049 15050 15051 15052 15053 15054 15055 15056 15057 15058 15059 15060 15061 15062 15063 15064 15065 15066 15067 15068 15069 15070 15071 15072 15073 15074 15075 15076 15077 15078 15079 15080 15081 15082 15083 15084 15085 15086 15087 15088 15089 15090 15091 15092 15093 15094 15095 15096 15097 15098 15099 15100 15101 15102 15103 15104 15105 15106 15107 15108 15109 15110 15111 15112 15113 15114 15115 15116 15117 15118 15119 15120 15121 15122 15123 15124 15125 15126 15127 15128 15129 15130 15131 15132 15133 15134 15135 15136 15137 15138 15139 15140 15141 15142 15143 15144 15145 15146 15147 15148 15149 15150 15151 15152 15153 15154 15155 15156 15157 15158 15159 15160 15161 15162 15163 15164 15165 15166 15167 15168 15169 15170 15171 15172 15173 15174 15175 15176 15177 15178 15179 15180 15181 15182 15183 15184 15185 15186 15187 15188 15189 15190 15191 15192 15193 15194 15195 15196 15197 15198 15199 15200 15201 15202 15203 15204 15205 15206 15207 15208 15209 15210 15211 15212 15213 15214 15215 15216 15217 15218 15219 15220 15221 15222 15223 15224 15225 15226 15227 15228 15229 15230 15231 15232 15233 15234 15235 15236 15237 15238 15239 15240 15241 15242 15243 15244 15245 15246 15247 15248 15249 15250 15251 15252 15253 15254 15255 15256 15257 15258 15259 15260 15261 15262 15263 15264 15265 15266 15267 15268 15269 15270 15271 15272 15273 15274 15275 15276 15277 15278 15279 15280 15281 15282 15283 15284 15285 15286 15287 15288 15289 15290 15291 15292 15293 15294 15295 15296 15297 15298 15299 15300 15301 15302 15303 15304 15305 15306 15307 15308 15309 15310 15311 15312 15313 15314 15315 15316 15317 15318 15319 15320 15321 15322 15323 15324 15325 15326 15327 15328 15329 15330 15331 15332 15333 15334 15335 15336 15337 15338 15339 15340 15341 15342 15343 15344 15345 15346 15347 15348 15349 15350 15351 15352 15353 15354 15355 15356 15357 15358 15359 15360 15361 15362 15363 15364 15365 15366 15367 15368 15369 15370 15371 15372 15373 15374 15375 15376 15377 15378 15379 15380 15381 15382 15383 15384 15385 15386 15387 15388 15389 15390 15391 15392 15393 15394 15395 15396 15397 15398 15399 15400 15401 15402 15403 15404 15405 15406 15407 15408 15409 15410 15411 15412 15413 15414 15415 15416 15417 15418 15419 15420 15421 15422 15423 15424 15425 15426 15427 15428 15429 15430 15431 15432 15433 15434 15435 15436 15437 15438 15439 15440 15441 15442 15443 15444 15445 15446 15447 15448 15449 15450 15451 15452 15453 15454 15455 15456 15457 15458 15459 15460 15461 15462 15463 15464 15465 15466 15467 15468 15469 15470 15471 15472 15473 15474 15475 15476 15477 15478 15479 15480 15481 15482 15483 15484 15485 15486 15487 15488 15489 15490 15491 15492 15493 15494 15495 15496 15497 15498 15499 15500 15501 15502 15503 15504 15505 15506 15507 15508 15509 15510 15511 15512 15513 15514 15515 15516 15517 15518 15519 15520 15521 15522 15523 15524 15525 15526 15527 15528 15529 15530 15531 15532 15533 15534 15535 15536 15537 15538 15539 15540 15541 15542 15543 15544 15545 15546 15547 15548 15549 15550 15551 15552 15553 15554 15555 15556 15557 15558 15559 15560 15561 15562 15563 15564 15565 15566 15567 15568 15569 15570 15571 15572 15573 15574 15575 15576 15577 15578 15579 15580 15581 15582 15583 15584 15585 15586 15587 15588 15589 15590 15591 15592 15593 15594 15595 15596 15597 15598 15599 15600 15601 15602 15603 15604 15605 15606 15607 15608 15609 15610 15611 15612 15613 15614 15615 15616 15617 15618 15619 15620 15621 15622 15623 15624 15625 15626 15627 15628 15629 15630 15631 15632 15633 15634 15635 15636 15637 15638 15639 15640 15641 15642 15643 15644 15645 15646 15647 15648 15649 15650 15651 15652 15653 15654 15655 15656 15657 15658 15659 15660 15661 15662 15663 15664 15665 15666 15667 15668 15669 15670 15671 15672 15673 15674 15675 15676 15677 15678 15679 15680 15681 15682 15683 15684 15685 15686 15687 15688 15689 15690 15691 15692 15693 15694 15695 15696 15697 15698 15699 15700 15701 15702 15703 15704 15705 15706 15707 15708 15709 15710 15711 15712 15713 15714 15715 15716 15717 15718 15719 15720 15721 15722 15723 15724 15725 15726 15727 15728 15729 15730 15731 15732 15733 15734 15735 15736 15737 15738 15739 15740 15741 15742 15743 15744 15745 15746 15747 15748 15749 15750 15751 15752 15753 15754 15755 15756 15757 15758 15759 15760 15761 15762 15763 15764 15765 15766 15767 15768 15769 15770 15771 15772 15773 15774 15775 15776 15777 15778 15779 15780 15781 15782 15783 15784 15785 15786 15787 15788 15789 15790 15791 15792 15793 15794 15795 15796 15797 15798 15799 15800 15801 15802 15803 15804 15805 15806 15807 15808 15809 15810 15811 15812 15813 15814 15815 15816 15817 15818 15819 15820 15821 15822 15823 15824 15825 15826 15827 15828 15829 15830 15831 15832 15833 15834 15835 15836 15837 15838 15839 15840 15841 15842 15843 15844 15845 15846 15847 15848 15849 15850 15851 15852 15853 15854 15855 15856 15857 15858 15859 15860 15861 15862 15863 15864 15865 15866 15867 15868 15869 15870 15871 15872 15873 15874 15875 15876 15877 15878 15879 15880 15881 15882 15883 15884 15885 15886 15887 15888 15889 15890 15891 15892 15893 15894 15895 15896 15897 15898 15899 15900 15901 15902 15903 15904 15905 15906 15907 15908 15909 15910 15911 15912 15913 15914 15915 15916 15917 15918 15919 15920 15921 15922 15923 15924 15925 15926 15927 15928 15929 15930 15931 15932 15933 15934 15935 15936 15937 15938 15939 15940 15941 15942 15943 15944 15945 15946 15947 15948 15949 15950 15951 15952 15953 15954 15955 15956 15957 15958 15959 15960 15961 15962 15963 15964 15965 15966 15967 15968 15969 15970 15971 15972 15973 15974 15975 15976 15977 15978 15979 15980 15981 15982 15983 15984 15985 15986 15987 15988 15989 15990 15991 15992 15993 15994 15995 15996 15997 15998 15999 16000 16001 16002 16003 16004 16005 16006 16007 16008 16009 16010 16011 16012 16013 16014 16015 16016 16017 16018 16019 16020 16021 16022 16023 16024 16025 16026 16027 16028 16029 16030 16031 16032 16033 16034 16035 16036 16037 16038 16039 16040 16041 16042 16043 16044 16045 16046 16047 16048 16049 16050 16051 16052 16053 16054 16055 16056 16057 16058 16059 16060 16061 16062 16063 16064 16065 16066 16067 16068 16069 16070 16071 16072 16073 16074 16075 16076 16077 16078 16079 16080 16081 16082 16083 16084 16085 16086 16087 16088 16089 16090 16091 16092 16093 16094 16095 16096 16097 16098 16099 16100 16101 16102 16103 16104 16105 16106 16107 16108 16109 16110 16111 16112 16113 16114 16115 16116 16117 16118 16119 16120 16121 16122 16123 16124 16125 16126 16127 16128 16129 16130 16131 16132 16133 16134 16135 16136 16137 16138 16139 16140 16141 16142 16143 16144 16145 16146 16147 16148 16149 16150 16151 16152 16153 16154 16155 16156 16157 16158 16159 16160 16161 16162 16163 16164 16165 16166 16167 16168 16169 16170 16171 16172 16173 16174 16175 16176 16177 16178 16179 16180 16181 16182 16183 16184 16185 16186 16187 16188 16189 16190 16191 16192 16193 16194 16195 16196 16197 16198 16199 16200 16201 16202 16203 16204 16205 16206 16207 16208 16209 16210 16211 16212 16213 16214 16215 16216 16217 16218 16219 16220 16221 16222 16223 16224 16225 16226 16227 16228 16229 16230 16231 16232 16233 16234 16235 16236 16237 16238 16239 16240 16241 16242 16243 16244 16245 16246 16247 16248 16249 16250 16251 16252 16253 16254 16255 16256 16257 16258 16259 16260 16261 16262 16263 16264 16265 16266 16267 16268 16269 16270 16271 16272 16273 16274 16275 16276 16277 16278 16279 16280 16281 16282 16283 16284 16285 16286 16287 16288 16289 16290 16291 16292 16293 16294 16295 16296 16297 16298 16299 16300 16301 16302 16303 16304 16305 16306 16307 16308 16309 16310 16311 16312 16313 16314 16315 16316 16317 16318 16319 16320 16321 16322 16323 16324 16325 16326 16327 16328 16329 16330 16331 16332 16333 16334 16335 16336 16337 16338 16339 16340 16341 16342 16343 16344 16345 16346 16347 16348 16349 16350 16351 16352 16353 16354 16355 16356 16357 16358 16359 16360 16361 16362 16363 16364 16365 16366 16367 16368 16369 16370 16371 16372 16373 16374 16375 | #
msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2010-12-28 03:03+0300\n"
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Language-Team: français\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-Language: French\n"
"X-Poedit-Country: FRANCE\n"
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr ""
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Réinitialiser toutes les préférences"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Réinitialiser tous les paramètres de la gouttière"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Réinitialiser toutes les préférences de texte"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Cette page ne représente pas vos paramètres courants. Voir la page avancée. Utilisez cette page pour pour réinitialiser les modifications avancées"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Général"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr "Standard, toutes les actions (point d'arrêt, pliage) sur clic"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr "Etendu, Actions (point d'arrêt, pliage) sur fin clic. Sélection sur clic et déplacement"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Gouttière"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Le clic droit déplace aussi le curseur"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Texte"
#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "Touche Alt active le mode colonne"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr "Ctrl + Clic gauche ..."
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr "va à l'implémentation"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr "saut vers la fin de l'implémentation/d'autres blocs"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr "Rien"
#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr "Double-cliquer sélectionne la ligne"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr "Ctrl + souris copie/colle la sélection"
#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr "va à l'implémentation"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "La bouton du milieu ..."
#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr "Rien"
#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr "colle la sélection"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Vous avez des modifications non enregistrées. L'utilisation de cette page annulera les modifications apportées sur la page avancée"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr ""
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Lecture seule"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minuscules, première lettre en majuscule"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Ajouter opérateur d'affectation :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
#, fuzzy
msgid "Brackets highlight"
msgstr "Parenthèses"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Arbre de pliage de code"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Texte par défaut"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Désactiver le point d'arrêt"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Activer le point d'arrêt"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Erreur ligne"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "point d'exécution"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "marqueur de code pliée"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Gouttière"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Ligne"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edition synchronisée"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Editer le modèle de code"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Texte"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Séparateur de gouttière"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
#, fuzzy
msgid "Incremental others"
msgstr "Recherche incrémentale"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Mettre en surbrillance le mot courant"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Recherche incrémentale"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Point d'arrêt invalide"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "surlignage de la ligne en cours"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Numéro de la ligne"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Lligne modifiée"
#: lazarusidestrconsts.dlgaddhiattrmouselink
#, fuzzy
msgid "Mouse link"
msgstr "Style de lien :"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Aire sélectionnée"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Cellule active"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Autres cellules"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Cellules synchronisées"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Cellule active"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Autres cellules"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Cellules synchronisées"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "bloc de texte"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Point d'arrêt inconnu"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Mot entre parenthèse"
#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Répertoire de recherche complémentaire pour tous les projets (.pp;.pas)"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Ajouter un point-virgule"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ajuster la ligne supérieure au commentaire qui précède"
#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Tous les fichiers"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alphabétiquement"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Curseur toujours visible"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Action sur fichier litigieux :"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Prévenir à la compilation"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Paramètres de l'application"
#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Valeur par défaut"
#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Inclure le code d'assertion"
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Créer les Fiches automatiquement:"
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Ajouter les nouvelles fiches à celles créées automatiquement"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Supprimer le fichier automatiquement"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Cacher la souris pendant la frappe"
#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "Indentation automatique"
#: lazarusidestrconsts.dlgautoindentlink
#, fuzzy
msgid "(Setup smart indent)"
msgstr "Indenter jusqu'à"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Supprimer automatiquement les méthodes vides"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Renommer les fichiers en minuscule"
#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Enregistrement automatique"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Fiches disponibles:"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Arrière-plan"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(pas de sous-dossier)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Même nom (dans un sous-répertoire)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Derrière les méthodes"
#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr "Sélection :"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Indentation de bloc"
#: lazarusidestrconsts.dlgblockindenttype
#, fuzzy
msgid "Indent method"
msgstr "Sauts"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr ""
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Position seulement"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Espaces"
#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "Compatibilité TP/BP 7.0"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Parenthèses"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""
#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "Fichier des messages du compilateur Pascal (*.msg)|*.msg|Any Files (*.*)|*.*"
#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Appliquer"
#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensible à la casse"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Vérification des options du compilateur"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Résultats"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test : Vérification compilateur ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test : Vérification de la configuration du compilateur ..."
#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Test : Vérification de la configuration fpc ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test : Vérification de la date du compilateur ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test : Compilation d'un fichier vide ..."
#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test : Vérification ppu fpc manquante ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test : Vérification des sources dans le chemin de recherche ppu fpc ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test : Compilation d'un fichier vide"
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordre des classes"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Fin"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minuscules"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Aperçu (longueur de ligne max. = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Préfixe \"Read\""
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Suffixe stocké"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAJUSCULE"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Préfixe des champs"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Préfixe \"Write\""
#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Centrer sur la ligne du curseur"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Enregistrer sous - renommer les fichiers pascal en minuscules"
#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Vérifier la cohérence"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Vérifier les paquets à la création de la fiche"
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Choisissez le fichier de modèle de code (*.dci)"
#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Politique d'insertion de portion de classe"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Afficher les boutons fermer dans l'éditeur"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Profils des couleurs"
#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "Macros de style C (globales)"
#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "Utiliser les chaînes ANSI"
#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "Tel quel"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Style d'assembleur :"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Messages"
#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Contrôles :"
#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Compilation"
#: lazarusidestrconsts.dlgcoconditionals
#, fuzzy
msgid "Conditionals"
msgstr "Afficher les expressions conditionnelles"
#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "Opérateurs de style C (*=, +=, /= et -=)"
#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "Créer un nœud fils"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Créer le Makefile"
#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "Créer un noeud au-dessus"
#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "Créer un noeud au-dessous"
#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Générer des infos pour le débogueur DBX (ralentit la compilation)"
#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Déboguage :"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Ajout d'un chemin au débogueur (aucun):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Création de code"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr ""
#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Souris"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""
#: lazarusidestrconsts.dlgcodegeneration
#, fuzzy
#| msgid "Code"
msgid "Code generation"
msgstr "Code"
#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "Options des Outils de code"
#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Code plus rapide"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Générer des infos pour le débogueur GDB (ralentit la compilation)"
#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Générer:"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Utiliser l'unité \"Heaptrc\""
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Inclusion des fichiers (-Fi) :"
#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Hérité"
#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Préserver certaines variables dans les registres"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Librairies (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Edition des liens"
#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Charger/Enregistrer"
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Couleur"
#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Exporter"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Modifie la couleur)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "non modifié"
#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Paramètres de ligne de commande"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Paramètres de la ligne de commande (sans le nom de l'application)"
#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr "Descendre"
#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr "Déplacer d'un niveau vers le bas"
#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr "Déplacer d'un niveau vers le haut"
#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr "Monter"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr "Messages du compilateur"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "fichier de langue des messages du compilateur"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Options du compilateur"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Compléter les propriétés"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Fichiers de configuration:"
#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Code normal"
#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Options : "
#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Autre"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Débordement"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analyse"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Copier/coller avec infos de pliage"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Copier le mot si rien à copier"
#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Intervalle"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Affiche les erreurs"
#: lazarusidestrconsts.dlgcoshowoptions
#| msgid "Show Options"
msgid "&Show Options"
msgstr "&Afficher les options"
#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Code plus petit"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Table des liens intelligente"
#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Autres sources (fichiers .pp/.pas; utilisé seulement par l'EDI, pas par le compilateur)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Pile"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Eliminer les symboles de l'exécutable"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Style de l'unité"
#: lazarusidestrconsts.dlgcouseasdefault
msgid "Use these compiler options as default for new projects"
msgstr "Utilisez ces options du compilateur par défaut pour les nouveaux projets"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Générer le code pour valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "faire des commentaires"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "INLINE style C++"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Curseur au-delà de la fin de ligne"
#: lazarusidestrconsts.dlgcursorgroupoptions
#| msgid "Cursor options:"
msgid "Cursor:"
msgstr "Curseur :"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Le curseur saute la sélection"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Curseur saute les tabulations"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Extension utilisateur (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editeur de chemin"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Type de débogueur et chemin"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Fonte par défaut pour l'éditeur"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valeur par défaut"
#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Extensions Delphi 2"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Supprimer le modèle de code"
#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Compatible Delphi"
#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Bureau"
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Boutons -"
#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Fichiers du bureauu"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Conseils"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menus - "
#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Options diverses"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Sens"
#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Le répertoire n'existe pas"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Désactiver l'anti-crénelage"
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Utilisez la couleur de la marge de droite"
#: lazarusidestrconsts.dlgdividerdrawdepth
#, fuzzy
msgid "Draw divider level"
msgstr "Niveau 2 (niveau 1 + optimisations rapide)"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "couleurs de ligne imbriquées"
#: lazarusidestrconsts.dlgdivideronoff
#, fuzzy
msgid "Draw divider"
msgstr "Dessin des séparateurs"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Couleur de ligne"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (local)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "divisions de l'unité"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "clause Uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Bas"
#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Ajouter"
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Retour"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Gras"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sous-répertoire"
#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Modèles de code"
#: lazarusidestrconsts.dlgedcolor
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Couleurs"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for pascal blocks"
msgstr "Ajoute close aux blocs en pascal"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Extension utilisateur"
#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Délai"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr ""
#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Supprimer"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Affichage"
#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Editer"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Editeur de fichiers"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Compléter l'identificateur"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverser"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignore les vérouillages, utilise le plus long éditeur non utilisé"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignore les vérouillages, si l'éditeur est celui en cours"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignore les vérouillages, si l'éduteur est la fenêtre en cours"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Verrouillé, si le texte en vue"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Dévérouillé"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Débloqué, si le texte en vue centré"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nouvel onglet,nouvelle fenêtre ou existante"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nouvel onglet dans nouvelle fenêtre"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nouvel onglet dans la fenêtre existante"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Cette option utilise le plus long éditeur non utilisé pour le fichier, même s'il est verrouillé et/ou a besoins de défilement. La détermination du plus long éditeur non utilisé ne regarde pas l'ordre dans lequel les fenêtre ont reçu le focus, même si c'est le jeux avec le paramètre pour \"même critère d'ordre\". Cette option va toujours reussirr, d'autres options ne sont jamais testés."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Cette option va vérifier si l'éditeur actif en cours a le fichier cible et si c'est le cas, il va utiliser l'éditeur en cours, même s'il est vérouillé et/ou a besoin de défiler."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Cette option va vérifier s'il y a un éditeur pour le fichier cible dans la fenêtre en cours et si il y est, il utilisera cet éditeur, même s'il est vérouillé et/ou a besoin de défiler."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Cette option va utiliser un éditeur vérouillé(et seulement vérouillé), lequel n'a pas besoin de défiler dans le but d'afficher le point de saut cible(le point de saut "
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Cette option utilisera n'importe quel éditeur non vérouillé."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Cette option n'utilisera pas un éditeur vérouillé, lequel n'a pas besoin de défiler dans le but d'afficher le point de saut cible(le point de saut cible est déjà dans la zone centre de l'écran visible, excluant 2-5 lignes en haut/bas)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Cette option va ouvrir un nouvel onglet dans une fenêtre existante ou nouvelle, si aucun onglet dévérouillé est trouvé. Cette option va toujours réussir, les options supplémentaires ne sont jamais testées."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Si aucun onglet dévérouillé est trouvé, alors cette option va ouvrir un nouvel onglet dans une nouvelle fenêtre(même si d'autres fenêtres existantes pourraient être utilisées pour le nouvel onglet). Cette option va toujours réussir, des options supplémentaires ne sont jamais testées."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Si aucun onglet dévérouillé est trouvé, alors cette option va ouvrir un nouvel onglet dans une fenêtre existante(et seulement dans une existante). Un onglet est seulement ouvert si une fenêtre existe, cela n'a pas encore d'éditeur pour le fichier cible."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Italique"
#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Fonte de l'éditeur"
#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Hauteur de la police de l'éditeur"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Options de l'éditeur"
#: lazarusidestrconsts.dlgeditschemdefaults
#, fuzzy
msgid "Scheme globals"
msgstr "Profils des couleurs"
#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Divers"
#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Pas d'erreurs trouvées dans l'assignation des touches"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Off"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "On"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Souligner"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Attributs des éléments"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Touche Fin va à la fin la plus proche"
#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "Portée &entière"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Demander"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Note : les fichiers du projet sont tous ceux figurant dans son répertoire"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Sauvegarde"
#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Couleurs"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Fichiers"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grille"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Langue"
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Lignes directrices"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Divers"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Aucun"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Autres fichiers"
#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projet"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Focus sur la fenêtre de messages après compilation"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Espace entre les caractères"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Interligne supplémentaire"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Utilisez un fichier de symboles de débogage externe pour gdb"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Extensions de fichier"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Chercher le texte sous le curseur"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr ""
#: lazarusidestrconsts.dlgfolddiffchunksect
#, fuzzy
msgid "Chunk section"
msgstr "Section Resourcestring :"
#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Fichier"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Commentaire"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Noeud"
#: lazarusidestrconsts.dlgfoldlfmitem
#, fuzzy
msgid "Item"
msgstr "Hauteur d'élément"
#: lazarusidestrconsts.dlgfoldlfmlist
#, fuzzy
msgid "List <>"
msgstr "Liste"
#: lazarusidestrconsts.dlgfoldlfmobject
#, fuzzy
msgid "Object (inherited, inline)"
msgstr "Copie depuis hérité "
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr ""
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (imbriqué)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr ""
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Commentaires imbriqués"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedure)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procédure"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programme"
#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "Enregistrement"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr ""
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unité"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Section Unit"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Commentaire"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr ""
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Noeud"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Instruction de traitement"
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Couleur d'avant-plan"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Politique d'insertion de procédure"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Préserver l'ordre des procédures"
#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Chemin du compilateur (%s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Répertoire des sources de FPC"
#: lazarusidestrconsts.dlgframecolor
#, fuzzy
#| msgid "Frame color"
msgid "Text-mark"
msgstr "Couleur de cadre"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editeur de fiches"
#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "&Depuis le curseur"
#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Options"
#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr "Génère de l'information minimale de débogage"
#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Lire la position"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"
#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Compatibilité GPC (GNU Pascal Compiler)"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Générer du code pour gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Couleur d'accroches"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Couleur de la grille"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Taille de grille X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Espacement horizontal de la grille"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Taille de grille Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Espacement vertical de la grille"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Outils de code"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Débogueur"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editeur"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Environnement"
#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Aide"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Grouper Défaire"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Afficher les lignes directrices"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Gouttière"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr ""
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Couleur de gouttière"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Couleur du bord de gouttière"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Index du séparateur de gouttière"
#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Largeur de gouttière"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Défilement d'une demi-page"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Taille de pile"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Hauteur:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Cacher l'EDI à l'exécution"
#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Cacher les icônes des messages"
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Cacher l'onglet dans les fenêtres d'une seule page"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Couleur de surlignage"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Couleur de surlignage pour la police"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Gauche du curseur"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Droite du curseur"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Afficher les conseils pour le paramètre \"Sender\" non utilisé"
#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Afficher les conseils pour les unités non utilisées"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "La touche Home va au plus proche début"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Application hôte"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Complétion de l'identificateur"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Politique des identificateurs"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Options IDE"
#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Ignorer"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Inclure les variables système"
#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Indenter jusqu'à"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
#| msgid "Indents/Tabs options:"
msgid "Indent and Tabs:"
msgstr "Indentations et tabulations :"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Devant les méthodes"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Le nom du constructeur doit être 'init' (le destructeur doit être 'done')"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Insérer un espace après"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Insérer un espace devant"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervalle en secondes"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Sauts"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "Préserver la position X du curseur"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Assignation des touches"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Erreurs d'assignation de touches"
#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Modèle de clavier"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Politique de mot-clé"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Autoriser LABEL et GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Langue"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Fin (du source)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Répertoire de Lazarus (défaut pour tous les projets)"
#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Gauche :"
#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "Couleur pour haut, gauche"
#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Niveau 1 (rapide et débogueur amical)"
#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Niveau 2 (niveau 1 + optimisations rapide)"
#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Niveau 3 (niveau 2 + optimisations lentes)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Niveau 0 (pas d'optimisations additionnelles)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Coupure de ligne"
#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Style de lien :"
#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Lier intelligemment"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Afficher les numéros de ligne dans les traces d'erreurs à l'exécution"
#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Charger les paramètres du bureau"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu principal"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Afficher les fiches du projet"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Afficher les cadres du projet"
#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Afficher les unités du projet"
#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Chemin de 'make'"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Marge et gouttière"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Couleur de signet"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match word boundaries for words up to this length:"
msgstr "trouver les limites de mot pour les mots jusqu'à cette longueur:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr "Ignore les mots clefs"
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr ""
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim Spaces (when highlighting current selection)"
msgstr "Retire les espaces(quand on surligne la sélection courante)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Nombre maximum"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Longueur max d'une ligne:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Fichiers récents max."
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Fichiers projet récents max."
#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Politique d'insertion des méthodes"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mélanger méthodes et propriétés"
#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Bouton"
#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Gauche"
#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Milieu"
#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Droite"
#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "Plie tout (quelques-uns réduits)"
#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "En plie un (quelques-uns réduits)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "Déplie tout(quelques-uns réduits)"
#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "En déplie un (quelques-uns réduits)"
#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Permis "
#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "Plie tout (tout développé)"
#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "En plie un(tout développé)"
#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Préférences 1"
#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr "Préférences 2"
#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmousegroupoptions
#| msgid "Mouse options:"
msgid "Mouse:"
msgstr "Souris :"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Simple"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr "Double"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr "Triple"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr "Quadruple"
#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Ajouter"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Tous"
#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Supprimer"
#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Bas"
#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Exporter"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "Importer"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Gauche"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Milieu"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
#, fuzzy
msgid "Make Fallback"
msgstr "Chemin de 'make'"
#: lazarusidestrconsts.dlgmouseoptbtnok
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Droite"
#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Changer"
#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Haut"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Capture"
#: lazarusidestrconsts.dlgmouseoptcaretmove
#, fuzzy
msgid "Move Caret (extra)"
msgstr "Le clic droit déplace aussi le curseur"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr ""
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Action"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Clic"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
#, fuzzy
msgid "Edit Mouse"
msgstr "(Modifie la couleur)"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Entrée dupliquée"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Cette entrée entre en conflit avec une entrée existante"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Bouton"
#: lazarusidestrconsts.dlgmouseoptheadcaret
#, fuzzy
msgid "Caret"
msgstr "Curseur ou Edition"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contexte"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Clic"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Action"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Up/Down"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Option"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Ordre"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorité"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Souris"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avancé"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Commande de l'IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Gouttière"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Arbre de pliage"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Réduit [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Développé [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "numéros de ligne"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Texte"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Sélectionner"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "D'autres actions utilisent le même bouton"
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr "Ils peuvent être exécutés en fonction des touches de modification, des définitions fallthrough, simple / double, haut / bas"
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
#, fuzzy
msgid "Filter Mod-Keys"
msgstr "Éditer les touches de la commande"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorité"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Messages"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Multi sélection"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr "trouver"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Classement à utiliser pour les éditeurs répondant aux mêmes critères"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Le plus récent éditeur ayant le focus pour ce fichier"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "L'Editeur(pour fichier) dans la plus récente fenêtre ayant le focus"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Liste prioritaire de critères pour choisir un éditeur:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Pages et fenêtres"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr "position des onglets de l'éditeur de source"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nommage"
#: lazarusidestrconsts.dlgnoautomaticrenaming
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Pas de renommage automatique"
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Pas de surlignage"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "position des onglets l'éditeur de source"
#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "Bas"
#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Gauche"
#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Droite"
#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "Haut"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Ne pas couper la ligne après :"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Ne pas couper la ligne avant :"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspecteur d'objets"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Hauteur d'élément"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Divers"
#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Options"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Configuration rapide"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Utiliser les paramètres par défaut de Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Utiliser les paramètres par défaut de Lazarus"
#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimisations:"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Autres fichiers unité (-Fu) (le délimiteur est le point-virgule):"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr "Ecraser le bloc"
#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr "Paquet Graph"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Conseils pour la palette de composants"
#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Extension Pascal par défaut"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr ""
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Passez des options à l'éditeur de liens (séparées par des espaces)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr ""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Valeur par défaut"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Aucun"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr ""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr "Bloc persistant"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Curseur persistant"
#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Groupe de paquets"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Application"
#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Effacer l'icônes"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Créer un Bundle Application"
#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr ""
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Fiches"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Icône :"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(taille: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "<Aucun>"
#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Changer icône"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Divers"
#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Réglages de sortie"
#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Enregistrer l'icône"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Session"
#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Fichier de destination:"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titre:"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Utiliser le paquet d'application pour exécuter et corriger (Darwin seulement)"
#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Utiliser le fichier manifeste pour activer les thèmes (Windows seulement)"
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Options du projet"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Options pour le projet: %s"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Fichiers projet"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "&Confirmer les remplacements"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Complétion de propriété"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "nom de propriété"
#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "ferme automatiquement la boite de dialogue de compilation"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Ouvrir le dernier projet au démarrage"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Afficher l'espacement des bordures"
#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Afficher le dialogue de compilation"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Afficher la grille"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Aligner sur la grille"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Référence"
#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Expressions régulières"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "&Remplacer tout"
#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "&Remplacer par"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapport"
#: lazarusidestrconsts.dlgrightbottomclr
#, fuzzy
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Aligner sur les lignes directrices"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Clic droit pour sélectionner"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Marge droite"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Répertoire de travail"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
#, fuzzy
msgid "Select grandchildren"
msgstr "Choisir un répertoire"
#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Création de code"
#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "colle la sélection"
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Affichage (pas pour Win32; par exemple : 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Environnement"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Local"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variables système"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Utiliser l'affichage"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Surcharge utilisateur"
#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "Valeur"
#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Variable"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Paramètres d'exécution"
#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Enregistrer les paramètres du bureau"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Lgne enregistrée"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Enregistrer les infos de l'éditeur seulement pour les fichiers projet"
#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Portée"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "faire défiler d'un de moins"
#: lazarusidestrconsts.dlgscrollgroupoptions
#| msgid "Scroll options:"
msgid "Scrolling:"
msgstr "Défilement :"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Afficher les conseils de défilement"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Défilement après la fin du fichier"
#: lazarusidestrconsts.dlgscrollpastendline
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Curseur dépasse la fin de ligne"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Répertoire de recherche \"%s\" non trouvé"
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Recherche interrompue par l'utilisateur."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Recherche ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Chemins"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "&Texte sélectionné"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Réinitialiser tous les éléments"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Réinitialiser l'élément"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Variable d'affectation"
#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Afficher les légendes des composants"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Afficher les procédures compilées"
#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Afficher les options du compilateur"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Afficher les numéros de ligne"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Afficher les expressions conditionnelles"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Afficher les informations de déboguage"
#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Afficher les macros définies"
#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Afficher les conseils dans l'éditeur"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Tout afficher"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Afficher les infos de l'exe (Win32 seulement)"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Afficher les informations générales"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Afficher les astuces de gouttière"
#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Afficher les conseils"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Afficher les numéros de ligne"
#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Afficher les notes"
#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Ne rien afficher (sauf les erreurs)"
#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Afficher les procédures en cas d'erreur"
#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Afficher les conseils de défilement"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Afficher le récapitulatif"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Afficher les fichiers essayés"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Afficher les fichiers utilisés"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Afficher les avertissements"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Affiche un seul bouton dans la barre des tâches"
#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr "Saut en avant dans les déclarations"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tabulations intelligentes"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbole derrière (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Compteur (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbole devant (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Aligner sur les lignes directrices"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Espace"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Conseils pour les principaux boutons rapides (Ouvrir, Enregistrer, ...) "
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editeur de source"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origine"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Mot-clé \"static\" dans les objets"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Arrêt après ce nombre d'erreurs:"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sous Propriétés"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Options des syntaxes"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulation indente les blocs"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Afficher les numéros d'onglet dans l'éditeur"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulations en espaces"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Largeur de tabulation"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "CPU de destination"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "OS de destination"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Plateformes cibles :"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processeur cible"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Répertoire pour construire les projets tests"
#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "&Texte à trouver"
#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Le répertoire \""
#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "Sec"
#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Evaluation d'expression ToolTip"
#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Outils des symboles Tooltip"
#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Haut:"
#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Fichier modèle"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr "Style de suppression des espaces"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Curseur ou Edition"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Ligne modifiée"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Quitter ligne"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Position seulement"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Enlever les espaces à la fin"
#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Optimisations incertaines"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Défaire après enregistrement"
#: lazarusidestrconsts.dlgundogroupoptions
#, fuzzy
#| msgid "Undo options:"
msgid "Undo / Redo:"
msgstr "Défaire / Refaire :"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Mémoire max pour l'annulation"
#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "Ouvrir"
#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Dépendances de l'unité"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Rafraîchir"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Répertoire de sortie pour les unités (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "ligne non enregistrée"
#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Haut"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Repliage de code"
#: lazarusidestrconsts.dlgusecustomconfig
#| msgid "Use addional Compiler Config File"
msgid "Use additional Compiler Config File"
msgstr "Utiliser un fichier de configuration supplémentaire du compilateur"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr "Dessin des séparateurs"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Utiliser le fichier de configuration standard du compilateur (fpc.cfg)"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Utiliser une application de démarrage"
#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "Utilise un fichier de messages"
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""
#: lazarusidestrconsts.dlguseschemedefaults
#, fuzzy
#| msgid "Use global scheme settings"
msgid "Use (and edit) global scheme settings"
msgstr "Utiliser les paramètres globaux du programme"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr ""
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Utiliser la coloration syntaxique"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valeur"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Messages détaillés pendant la compilation:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Gouttière visible"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Marge droite visible"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&Mots entiers seulement"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Largeur:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Application Win32 gui"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Fenêtre "
#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Positions des fenêtres"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Mots"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Aperçu"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "Insérer un logo FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Les composants sélectionnés doivent être sur une même fiche."
#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Aligner"
#: lazarusidestrconsts.fdmdeleteselection
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Effacer la sélection"
#: lazarusidestrconsts.fdmmirrorhorizontal
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Miroir Horizontal"
#: lazarusidestrconsts.fdmmirrorvertical
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Mirroir Vertical"
#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Ordre"
#: lazarusidestrconsts.fdmorderbackone
#| msgid "Back one"
msgid "Back One"
msgstr "Déplacer d'un vers arrière"
#: lazarusidestrconsts.fdmorderforwardone
#| msgid "Forward one"
msgid "Forward One"
msgstr "Déplacer d'un vers l'avant"
#: lazarusidestrconsts.fdmordermovetoback
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Déplacer vers l'arrière"
#: lazarusidestrconsts.fdmordermovetofront
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Déplacer vers l'avant"
#: lazarusidestrconsts.fdmsaveformasxml
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Enregistrer le formulaire en xml"
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Ajuster"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Tout sélectionner"
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Taille"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Option : aligner sur la grille"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Option : aligner sur les lignes guides"
#: lazarusidestrconsts.fdmtaborder
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Odre des onglets..."
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-order"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Des deux côtés"
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr ""
#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Ajouter un fichier"
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Ajouter des fichiers"
#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Ajouter fichiers au paquet"
#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "Ajouter les fichiers LFM et LRS, s'ils existent."
#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Ajouter au paquet"
#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Ajouter l'unité"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Type d'ancêtre ambigu"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nom de classe ambigu"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nom d'unité ambigu"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Type d'ancêtre"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dépendances brisées"
#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<choisir un fichier existant>"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Nom de classe déjà existant"
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Créer un nouveau fichier"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dépendance"
#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sFichier existant : %s%s%s"
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Fichier déjà existant"
#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Le fichier %s%s% existe déjà dans le projet."
#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Fichier déjà dans le paquet"
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Fichier en cours d'utilisation"
#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Nom de fichier:"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Nom de fichier"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Le fichier n'est pas une unité"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Type d'ancêtre non valide"
#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Cercle invalide"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nom de class non valide"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Fichier non valide"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nom de fichier non valide"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nom d'unité non valide"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s n'est pas un nom d'unité valide."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nouveau nom de class:"
#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Nouveau composant"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nouveau fichier"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Pas de paquet trouvé pour la dépendance %s%s%s.%sChoisissez un paquet existant svp."
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nom de page trop long"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Page de palette :"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Les unités Pascal doivent avoir l'extension .pp ou .pas"
#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Dialogue de sauvegarde de fichier"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Raccourcir ou augmenter le nom de fichier"
#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Afficher Tout"
#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Echanger les chemins"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Le type parent %s%s%s a le même nom que%sl'unité %s%s%s."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Le type parent %s%s%s n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Le nom de classe %s%s%s et le type ancêtre %s%s%s sont identiques"
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Le nom de classe %s%s%s existe déjà dans%sPaquet %s%sFichier : %s%s%s"
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Le nom de classe %s%s%s est identique au nom de%sl'unité %s%s%s."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Le nom de classe %s%s%s n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Le fichier %s%s%s est déjà dans le paquet."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Le fichier %s%s%s fait partie du projet en cours.%sC'est une mauvaise idée de partager des fichiers entre projets et paquets."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Le nom de fichier %s%s%s est ambigu, parce que le paquet n'a aucun répertoire par défaut.%sVeuillez indiquer un nom de fichier avec le chemin complet."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La version maximale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La version maximale est inférieure à la version minimale."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La version minimale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Le paquet a déjà une dépendance avec le paquet %s%s%s."
#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Le nom de page %s%s%s est trop long (max 100 caractères)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Le nom d'unité %s%s%s existe déjà dans le paquet:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Le nom d'unité %s%s%s existe déjà dans ce paquet."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Le nom d'unité %s%s%s%set nom de fichier %s%s%s diffèrent."
#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Le nom d'unité %s%s%s ne correspond pas au nom de fichier."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Le nom d'unité %s%s%s est le même qu'un composant installé.%sUtiliser ce nom peut causer d'étranges messages erreurs."
#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Nom de fichier de l'unité:"
#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Nom du fichier de l'unité:"
#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Nom d'unité:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nom d'unité déjà existant"
#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Nom d'unité non valide"
#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Rechercher dans l'unité son nom et la procédure Register"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Annuler les changements ?"
#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Une erreur est survenue pendant la création du Bundle Application :"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Arrêter tout"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Arrêter tous les chargements"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Arrêter le chargement du projet"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Arrêter tous les chargements"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentation :"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr ""
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "A propos de Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licence : GPL/LGPL%sLazarus est un EDI pour créer des applications (graphiques et consoles ) avec Free Pascal. Free Pascal est un compilateur (L)GPL Pascal et Pascal Objet fonctionnant sous Windows, Linux, Mac OS X, FreeBSD et plus .%sLazarus est une pièce maîtresse pour le développement d'applications multi-plateformes. A l'image de Delphi (uniquement sous Windows) cet EDI (Environnement de développement intégré ou IDE en anglais) est un outil de \"Développement rapide d'applications\" (ou RAD an anglais).%sComme Lazarus croît nous avons besoin de plus de développeurs."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Ne peut trouver la liste des contributeurs"
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Officiel :"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "Un %s ne peut contenir de TControls.%sVous pouvez seulement y mettre des composants non visuels."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Remerciements"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Action :"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Actions :"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Activer la syntaxe d'expression régulière pour le texte et les remplacements (assez semblable à perl)"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr ""
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtre actif"
#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "Ajouter un répertoire"
#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Ajouter fichiers du répertoire"
#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Options de compilation additionnelles héritées des paquets"
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr ""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr ""
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Ajouter un nouveau jeux"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "condition requise pour l\"ajout de paquet ?"
#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Ajoute le paquet %s au projet?"
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Ajoute un paquet au projet"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Ajouter un paramètre entre parenthèses"
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Ajouter %s au projet?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Ajouter l'unité au chemin de recherche?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Ajoutez les interfaces d'unité"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Ajoutez une unité(non recommandé)"
#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "Ajoute une valeur"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr ""
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Ajouter un fichier au paquet"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Paquet de destination"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Type de fichier"
#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "A une procédure Register"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Paquet non valide"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "ID de paquet non valide : %s%s%s"
#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Unité virtuelle (source pas dans le paquet)"
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Le paquet est en lecture seule"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Paquet %s%s%s non trouvé"
#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Afficher tout"
#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Le fichier %s%s%s%s est déjà dans le paquet %s."
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Le paquet %s est en lecture seule."
#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Nom d'unité: "
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Le fichier %s%s%s existe déjà. %Le remplacer ?"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Alignement"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Tous les blocs sont ok."
#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Tous les fichiers"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Toutes les options héritées"
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Autoriser les appels de fonctions"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Autoriser la recherche de lignes multiples"
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Toutes vos modifications %s%s%s%s seront perdues et le fichier réouvert."
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Touche alternative"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Touche alternative (ou une séquence de 2 touches)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Toujours"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Ignore toujours"
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Fichier litigieux trouvé"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Fichier litigieux trouvé: %s%s%s%sCe fichier peut être confondu avec %s%s%s%s%sSupprimer le fichier litigieux ?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Fichiers ambigus trouvés"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Unité ambigüe trouvée"
#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Unité ambigüe trouvée"
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editeur d'ancre - aucune commande choisie"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Activer = Inclure %s dans les ancres"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ancres des commandes sélectionnées "
#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Ancrer au côté inférieur du contrôle, préserver l'espace de bordure"
#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Ancrer au côté gauche du contrôle, préserver l'espace de bordure"
#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Ancrer au côté droit du contrôle, préserver l'espace de bordure"
#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Ancrer au côté supérieur du contrôle, préserver l'espace de bordure"
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Un erreur a eu lieu au démarrage précédent pendant le chargement %s!%s%sCharger ce projet à nouveau ?"
#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "Ajouter une brève description à la longue description"
#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#, fuzzy
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Application%sUn programme graphique LCL/FreePascal. Le fichier programme est automatiquement géré par Lazarus."
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nom de class &Application"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "applique l'option de construction (-B) aussi aux dépendances"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Une unité du projet ne peut pas être utilisée par d'autres paquets/projets"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "L'espace de bordure autour de la commande. Les quatre autres espaces de bordures sont ajoutés à cette valeur."
#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Un simple fichier programme en pascal. %sCela peut être utilisé pour un essai rapide. %sCréez plutôt un nouveau projet."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Demander avant de remplacer chaque texte trouvé"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "demande le nom du composant après l'avoir déposé sur le concepteur de fiche"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Demander le nom de fichier pour les nouveaux fichiers"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Demande le nom de fichier pendant la création"
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "complétion automatique: off"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Auto complétion: on"
#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "Continue automatiquement"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Continue automatiquement après:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""
#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr ""
#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr "converti automatiquement les fichiers .lfm vers les fichiers d'inclusion .lrs"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Appelé automatiquement après le point"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "Saut de ligne"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "Espace"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "Fin de mot"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "N'ajoutez pas de caractère"
#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Dispositifs automatiques "
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Afficher automatiquement l'Inspecteur d'objets"
#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Paquets disponibles"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Faire la sauvegarde des fichiers ayant changé"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "La sauvegarde du fichier a échoué"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr ""
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Le changement du nom ou de la version d'un paquet brise les dépendances. Est-ce que ces dépendances doivent être changées aussi?%sOui pour modifier toutes les dépendances listées. %Ignorer pour briser les dépendances et continuer."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "commence"
#: lazarusidestrconsts.lisbehindrelated
#, fuzzy
msgid "Behind related"
msgstr "Derrière les méthodes"
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Toujours construire avant l'exécution"
#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Construire"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Commande de construction"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "A la construction du projet, lancer la commande Construire Fichier à la place"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "A l'éxécution du projet, lancer la commande Exécurer Fichier à la place"
#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Exécuter"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Exécuter une commande"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Quand ce fichier est en cours d'utilisation dans l'éditeur de source ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Valeurs modifiées en gras"
#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "Espace de bordure"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Bas"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "L'espace inférieur de bordure. Cette valeur est ajoutée à l'espace bas de bordure et employée pour l'espace au-dessous de la commande."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancrage au bas de page"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bas"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "C'est le contrôle à laquelle le côté inférieur est ancré. Laisser vide pour le parent."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Espacement égal au bas"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Pause"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Propriétés du point d'arrêt"
#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Rechercher le compilateur (%s)"
#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Pause"
#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Continuer"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Rechercher"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Remplacer"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "Construire tous les fichiers de project/package/IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "Construire l' IDE avec les paquets"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "La construction de Lazarus a échoué"
#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr ""
#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr ""
#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "Mode construction"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr ""
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr ""
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Construire un nouveau projet"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Numéro de construction"
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "L'appel de %s pour créer le Makefile depuis %s a échoué."
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Annuler le chargement de ce composant"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Abandonner le chargement d'unité"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Abandonner le renommage"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr ""
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Ne peut copier le composant de niveau supérieur"
#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Impossible de créer le fichier %s%s%s"
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Lanceur Lazarus introuvable:%s%s"
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Peut seulement changer la classe de TComponents."
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Changer la classes de %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "Aucune classe"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilateur Ambigu"
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Veuillez vérifier le répertoire de Test dans %sEnvironment -> Options d'environnement -> Fichiers -> Répertoire pour construire les projets tests"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Le compilateur \"%s\" n'est pas un fichier exécutable. %s Détails : %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contient "
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copier la sortie vers le presse-papier"
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Les dates des fichiers .ppu de FPC diffèrent de plus d'une heure. %s Cela peut signifier, qu'elles proviennent de deux installations différentes. %s Fichier1 : %s%s Fichier 2 : %s"
#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "Fichier de message Anglais fpc est manquant : composants/codetools/fpc.errore.msg"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Erreur"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERREUR :"
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Chemin des unités FPC contient une source :"
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "Symboles de retour à la ligne"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "CONSEIL :"
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilateur non valide"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Chemin de recherche non valide"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Répertoire Test non valide"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unité manquante"
#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "Unité FPC compilée introuvable : %s.ppu"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "Multiples configurations de compilateur trouvées :"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "Aucun fpc.cfg trouvé"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "Sans ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "PPU existe deux fois: %s, %s"
#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "L'unité FPC compilée %s.ppu n'a pas été retrouvée.%s Ce message signifie généralement que votre fpc.cfg a un bug. Ou que votre installation FPC est cassée."
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Il y a un fichier .ppu plus ancien que le compilateur lui-même: %s%s"
#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "Chemin relatif de l'unité trouvé dans fpc cfg:%s"
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Il y a plusieurs FreePascal Compilateurs dans votre chemin. %s%s%s Peut-être avez-vous oublié de supprimer un vieux compilateur ?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Ignorer"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "Caractères spéciaux"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Tous les tests ont réussi."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Impossible de créer le fichier de test"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Impossible de créer le fichier de test Pascal \"%s\"."
#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Impossible d'obtenir la date du fichier %s."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "Caractères insolites"
#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Attention"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ATTENTION :"
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "Mauvais chemin du délimiteur"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Catégories"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complexité"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Constantes"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "blocs vides"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Sections de classe vide"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Vider les constructions"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procédures vides"
#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filtre)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Suivre le curseur"
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s dans %s"
#: lazarusidestrconsts.lisceisarootcontrol
#, fuzzy
msgid "Is a root control"
msgstr "Le contrôle nécessite un parent"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr "Nombre de paramètres traités comme \"beaucoup\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procédures longues"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Nombre de lignes de la procédure traité comme \"long\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "plusieurs procédures imbriquées"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Beaucoup de paramètres"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Afficher les catégories"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Afficher les nœuds sources"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr "procédures imbriquées avec un nombre qualifié de \"beaucoup\""
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Commande centrale horizontale relative au contrôle donné"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Commande centrale verticale relative au contrôle donné"
#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr "Centre la fiche"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centrer dans la fenêtre"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centres"
#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Mode d'exposition préféré"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Catégorie"
#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr "Source"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Jamais, seulement manuellement"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Seulement utilisé dans le mode catégorie"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Quand inoccupée."
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Rafraîchir automatiquement"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Autre"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Mise à jour "
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "En commutant le fichier dans l'éditeur de source "
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procédures"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Propriétés "
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Propriétés published sans défaut"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "montre les observations à propos"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Style"
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "ToDos"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Types"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "constantes sans nom"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "membres non triés"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilité non triée"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variables"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Mauvaise indentation"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Modifier la classe"
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Changer l'encodage"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Changer de fichier"
#: lazarusidestrconsts.lischangeparent
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "Changer le parent..."
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Caractère"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Table des caractères"
#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Vérifier les changements sur le disque avec le chargement "
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr ""
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Vérifiez les options"
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Choisissez un nom différent"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Choisissez un lien FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Choisir une touche ..."
#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Choisir un nom de pour le nouveau composant"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "Choisissez un fichier Pascal pour des exemples d'indentation"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Choisir le fichier des messages de compilation"
#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Choisissez le nom de fichier du compilateur"
#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Choisissez le nom de fichier du débogueur"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Choisissez le paquet Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Choisissez le projet Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Choisissez l'unité Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Choisissez le répertoire"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Choisissez le répertoire des sources de FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Choisissez le répertoire de Lazarus"
#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Choisissez le chemin \"make\""
#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Choisissez le nom"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Choisissez un de ces items pour créer un nouveau fichier"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Choisissez un de ces items pour créer un nouveau paquet"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Choisissez un de ces items pour créer un nouveau projet"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Choisissez un de ces éléments pour hériter d'un existant"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Choisissez le source du programme (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Choisissez la structure pour entourer la sélection"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Choisissez le répertoire de tests"
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Complétion de classe"
#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Conflits de classe avec le fichier .lfm : %s L'unité %s%s utilise l'unité %s%squi contient la classe %s,%smais le fichier .lfm contient déjà une autre classe.%s Il ne peut y avoir qu'une conception de classe par unité.%sS’il vous plaît déplacez %s dans une autre unité."
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Les classes et les propriétés existent. Les valeurs n'ont pas été vérifiées."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "La classe %s%s%s n'est pas une classe de composants référencée.%sIncapable de coller."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe introuvable"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Class %s%s%s de la méthode %s%s%s introuvable."
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Nettoyage de répertoire"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Nettoyer les sous-répertoires"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Préserver tous les fichiers texte"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Préserver les fichiers correspondant au filtre"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Retirer les fichiers correspondants au filtre"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Syntaxe simple (i.e. * au lieu de .*)"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Nettoyer les sources Lazarus"
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "nettoyer le chemin des unités"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Nettoyer le répertoire ?"
#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr "Effacer l' affectation des touches "
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Cliquez ici pour parcourir le fichier"
#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""
#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "&Fermer"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Fermer les fichiers"
#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Cacher la fenêtre"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Fermere une fenêtre de l'éditeur de source. Voulez-vous fermer tous les fichiers ou masquer la fenêtre?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Fermer la fenêtre d'édition source"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Options spécifiques à l'interface LCL:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Paramêtre"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Composants"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Héritage"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Liste"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Palette"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Fichier litigieux de configuration additionnel du compilateur"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Appel sur :"
#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Construire"
#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Compiler"
#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Exécuter"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sCliquez sur OK si vous en êtes sûr"
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Commande :"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""
#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Navigateur de code"
#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"
#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "défaut (%s)"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Options de génération de code"
#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Ajouter un lien"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Ajouter chemin"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Parcourir"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Confirmez remplacer"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Créer un item d'aide"
#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Supprimer le lien"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Retirer le chemin"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Description"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Erreurs"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Exemple"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Insérer une balise de formatage gras"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Insérer une balise de formatage code"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Insérer une balise de formatage italique"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Insérer une balise de formatage remarque"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Insérer une balise de formatage souligner"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Insérer une balise de formatage variable"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Hérité"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Insérer un lien"
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Insérer une balise de formatage paragraphe"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "Editeur FPDoc"
#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "<Aucun>"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(pas de description héritée trouvées)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NONE>"
#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "Chemin des fichiers FPDoc"
#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "Remplacer"
#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "Enregistrer"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Voir aussi"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Courte description de"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Court"
#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Afficher les méthodes vides"
#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr "Montre les unités non utilisées"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignore les constantes dans les fonctions suivantes"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Rechercher des constantes de type char sans nom "
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Observateur de code"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorer les prochaines constantes sans nom"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Ajouter"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Ajouter modèle de code"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr "Le raccourci %s%s%s existe déjà"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Auto compléter sur ..."
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Changer"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commentaire :"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Editer les modèles de code"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Erreur"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Jeton:"
#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "Outils de code"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Action : %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Les noeuds créés automatiquement ne peuvent être modifiés,%set ne peuvent pas avoir de sous-noeud non automatique"
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, généré automatiquement"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Les noeuds générés automatiquement ne peuvent pas être édités."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Bloc"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editeur des directives des outils de code ..."
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Définitions des Outils de code"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "Chemin du compilateur"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Convertir un noeud"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Créer les définitions pour le répertoire %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Créer les définitions pour le compilateur Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Créer Définitions pour des sources Free Pascal SVN"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Créer les définitions pour le répertoire Lazarus"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Créer les définitions pour le projet %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Créer les Macros et chemins FPC pour un répertoire projet fpc"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Définir"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Définir de manière récursive"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Supprimer le noeud"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Le réperoire principal %s %soù Borland a installé tous les sources %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Le répertoire principal %s où Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Description :"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "répertoire %s"
#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Editer"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Autrement"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Erreur lors de la lecture de %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Erreur de lecture des infos de projet %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Erreur lors de l'écriture %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Erreur lors de l'écriture du fichier infos projet %s%s%s%s%s"
#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Quitter"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Quitter sans enregistrer"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Répertoire des sources FPC SVN"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "Si"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Répertoire"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Insérer un modèle compilateur Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Insérer un modèle répertoire Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Insérer un modèle projet Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Insérer un modèle compilateur Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Insérer un modèle répertoire Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Insérer un modèle projet Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Insérer un modèle compilateur Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Insérer un modèle répertoire Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Insérer un modèle projet Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Insérer un modèle compilateur Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Insérer un modèle projet Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Insérer la source d'exemple Free Pascal SVN"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Insérer un modèle compilateur Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Insérer un modèle répertoire Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Insérer un modèle projet Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Insérer un modèle répertoire Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Insérer un noeud enfant"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Insérer un noeud ci-dessous"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Insérer un modèle"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Parent non valide"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Noeud parent non valide"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Noeud précédent non valide"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Le réperoire principal %s %soù Borland a installé tous les sources %s.%sPar exemple: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Le répertoire principal %s, où Borland a installé tous les sources %s %squi sont utilisés dans ce projet %s.%sPar exemple: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Répertoire Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Déplacer le noeud vers le bas"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Déplacer le noeud d'un niveau vers le bas"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Déplacer le noeud d'un niveau vers le haut"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Déplacer le noeud vers le haut"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nom :"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NouveauNoeud"
#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Le noeud et ses enfants sont seulement valides pour ce projet"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Noeud en lecture seule"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Aucun sélectionné"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Le noeud parent ne peut contenir d'enfants"
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Le noeud précédent ne peut contenir de noeuds enfants"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Répertoire du projet"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s répertoire de projet"
#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, spécifique au projet"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Erreur de lecture"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Enregistrer et quitter"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Noeud sélectionné:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Le répertoire source de Free Pascal SVN. Non requis. Ceci améliorera la déclaration et le déboguage."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Le répertoire du projet Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Le dossier source SVN Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Le répertoire principal de Lazarus"
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Le chemin du compilateur Free Pascal.%s Par exemple %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Le chemin du compilateur de Free Pascal pour ce projet. Seulement requis si vous placiz la source de FPC SVN ci-dessous. Utilisé pour l'auto-création de macros."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Le répertoire projet %s,%squi contient les fichiers .dpr, .dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Supprimer la définition"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Supprimer toutes les définitions"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Supprimer les définitions récursivement"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valeur en chemins fichier"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valeur en texte"
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variable:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Erreur d'écriture"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "De"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parenthèses"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Deux-points"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Virgule"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificateur"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Mot-clé"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "NouvelleLigne"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Aucun"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nombre"
#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "OK"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Point"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Point-virgule"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Espace"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Constante chaîne"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbole"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Exécuter après"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Exécuter avant"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Replier toutes les classes"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Replier tous les paquets"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Replier toutes les unités"
#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Commande suivante"
#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Commande suivante invalide"
#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Commande après publication du module"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Paramètres d'éxécution du programme"
#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "Compiler l'EDI (sans assemblage)"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilateur"
#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Erreur du compilateur"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Erreur : compilateur invalide: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nom de fichier du compilateur"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Conseil : vous pouvez définir le chemin du compilateur dans Configuration->Options d'environnement->Fichiers->Chemin du compilateur."
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOTE : fichier de configuration codetools non trouvé. Valeurs par défaut utilisées."
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOTE : chargement de l'ancien fichier d'options de codetools"
#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Options du compilateur pour le projet %s"
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compilation ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Jamais"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""
#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "Composant"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr ""
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Le nom du composant %s%s%s est un mot réservé"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Le nom du composant %s%s%s n'est pas un identificateur valide"
#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Rechercher un Composant"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Ouvrir un paquet"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Ouvrir l'unité"
#: lazarusidestrconsts.liscomptest
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condition"
#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr ""
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Répertoire de configuration de Lazarus"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Configurer Construire %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "Configurer %sConstruire Lazarus%s"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr ""
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Confirmer les changements"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Confirmer l'éffacement"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, fuzzy
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Voulez-vous reconstruire Lazarus ?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Confirmez le nouvel ensemble de paquets pour l'EDI"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Action"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nouveau jeu de paquet"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Vieux jeu de paquet"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Application console"
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Code Constructor"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contient"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensible au contexte"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Continuer"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr ""
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continuer sans charger la fiche"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Contributeurs"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Le contrôle nécessite un parent"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr ""
#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr ""
#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr ""
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr ""
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr ""
#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr ""
#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr ""
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr ""
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr ""
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Erreur de conversion"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Convertir"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Changer l'encodage"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Convertir le codage de projets/packages"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Convertir le projet ou le paquet"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""
#: lazarusidestrconsts.lisconverttargetlaz
#, fuzzy
#| msgid "Lazarus / LCL"
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lisconverttargetlazanddelphi
#| msgid "Lazarus / LCL for Windows only"
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr ""
#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr ""
#: lazarusidestrconsts.lisconverttargetlazwinonly
#| msgid "Both Lazarus / LCL and Delphi"
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr ""
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr ""
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr ""
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr ""
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr " Replacements de Type"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr ""
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Types à remplacer"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Remplacements d'unité"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unités à remplacer"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr ""
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Copier tout"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr "Copier tous les éléments vers le presse-papier"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Copier toutes les sorties vers le presse-papier"
#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr "Copie tout les messages cachés et montrés vers le presse-papier"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr "Copie tout les messages montrés vers le presse-papier"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copier la description dans le presse papier"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Erreur de copie"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Copier l'erreur"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Copier %s%s%s dans le presse-papiers"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "La copie d'une fiche complète n'est pas encore implémentée."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr "Copier l'élément vers le presse-papier"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr "Copier les éléments sélectionnés vers le presse-papier"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Copier les messages sélectionnés dans le presse-papier"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Rechercher les messages FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Rechercher les messages Make"
#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Afficher tous les messages"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Pas d'appel au compilateur"
#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Options spécifiques à l'OS de destination"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "N'a pas pu ajouter %s{$I %s%s} à la source principale!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "N'a pas pu ajouter %s{$R %s%s} à la source principale!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "N'a pas pu ajouter %s%s%s à la source principale!!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Impossible de supprimer %s%s%s de la source principale !"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "N'a pas pu enlever %s{$I %s%s} de la source principale!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "N'a pas pu enlever %s{$R %s%s} de la source principale!"
#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (divers)"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Avertissement: le fichier additionnel de configuration du compilateur porte le même nom qu'un des fichiers standards utilisés par le compilateur FreePascal. La conséquence risque d'être que SEUL le fichier additionnel sera utilisé tandis que le fichier standard sera ignoré."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Ouvrir le paquet %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Ouvrir l'unité %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Veuillez d'abord créer un projet !"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Créer le répertoire ?"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Crée une fonction"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Créer un item d'aide"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Le créer"
#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Créer un nouveau projet"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Créer un projet"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ""
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr ""
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Choisissez le répertoire"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Outils de code Répertoire de valeurs"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Définir les modêles"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<aucune variable choisie>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Ouvrir l'aperçu"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Outils"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variable: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nom de variable"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modèles"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "veuillez choisir une macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "veuillez choisir une macro"
#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr "Courant"
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Colonne du curseur dans l'éditeur courant"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Ligne du curseur dans l'éditeur courant"
#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr ""
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "Options personalisées"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Options personnalisées"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programme personnalisé"
#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Programmeen usage%sUn programme FreePascal"
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Module de données"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Date"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr ""
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Supprimer"
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Supprimer"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr ""
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Pas de débogueuer spécifié"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Placer le point d'arrêt de toute façon"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Il n'y a aucun débogueur d'indiqué.%sPlaçer des points d'arrêts n'aura aucun effet jusqu'à ce qu'un débogueur soit configuré dans le dialogue des options du débogueur dans le menu."
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr ""
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""
#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Erreur du débogueur"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Erreur du débogueur%sLe débogueur est en état d'erreur%sEnregistrez votre travail maintenant!%sCliquez sur Stop et espérez; nous ne répondons plus de rien !"
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Débogueur non valide"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (débogage ...)"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Ajouter une exception"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Chemin de recherche additionnel"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Point d'arrêt"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Effacer les logs à l'exécution"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Débogueur"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Options général du débogueur"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Options spécifiques du débogueur (dépend du type de débogueur)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Dupliquer le nom de l'exception"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Entrer le nom de l'exception"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Journal des événements"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Géré par"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Géré par le Débogueur"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Géré par le Programme"
#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorer ces exceptions"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Exceptions de langue"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Limiter le comptage des lignes à "
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Module"
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Nom"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Avertissement sur les exceptions de Lazarus"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Exceptions du système d'exploitation"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Sortie"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processus"
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Résumé"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Résumer le Handled"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Resume Unhandled"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Afficher le message à l'arrêt"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signaux"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Fenêtre "
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Impossible de charger le fichier."
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Impossible de charger le fichier %s%s%s."
#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr "Décimale"
#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "Valeur initiale"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr ""
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "délai pour les conseils et la boite de completion de code"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Supprimer tout"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Supprimer tous les points d'arrêts ?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Supprimer tous les points d'arrêts dans le fichier %s%s%s?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Supprimer tous dans le même source"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Supprimer tous les points d'arrêts sélectionnés ?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Détruire ces fichiers ?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Supprimer les fichier ambigus ?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Supprimer un point d'arrêt"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Supprimer le point d'arrêt à%s\"%s\" ligne %d ?"
#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr ""
#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr "Arrêter le mode construction"
#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "Supprimer le mode construction?"
#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr "Supprimer le mode construction %s%s%s?"
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "La suppression du fichier a échoué"
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr ""
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr ""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Supprimer l'ancien fichier %s%s%s ?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Supprimer l'ancien fichier ?"
#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "Supprimer la ligne"
#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Supprimer les fichiers sélectionnés ?"
#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr " Effacer les paramètres"
#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr " Effacer les paramètres ?"
#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr " Effacer les paramètres %s%s%s?"
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Supprimer le Valeur %s%s%s"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr ""
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "La suppression de l'ancien fichier %s%s%s a échoué."
#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"
#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "paquet Delphi"
#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Projet Delphi"
#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Unité Delphi"
#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Il y a déjà un autre composant avec le nom %s%s%s."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Répertoire de destination"
#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Le répertoire de destination %s%s%s est non valide.%s Veuillez choisir un chemin complet."
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Code Destructor"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Insensible à la casse"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorer lignes vides ajoutées ou supprimées"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorer les différences de fin de lignes (#10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorer le nombre d'espaces"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorer les espaces (sauf caractères de saut de ligne)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorer les espaces en fin de ligne"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorer les espaces en début de ligne"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Sélection seulement"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Ouvrir Différences dans l'éditeur"
#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Texte1"
#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Texte2"
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Chiffres :"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Directives"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr ""
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Répertoire %s%s%s non trouvé."
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "répertoire protégé en écriture."
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr ""
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Désactiver tous dans la même source"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Désactiver le point d'arrêt"
#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Désactiver"
#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr "Désactiver le groupe"
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr ""
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembleur"
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr ""
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr ""
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Annuler les changements"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr ""
#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Fichiers modifiés:"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Cliquez sur un des éléments ci-dessous pour voir les différences"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Erreur de lecture du fichier : %s"
#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Ignorer les changements sur disque"
#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Recharger depuis le disque"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Certains fichiers ont changé sur le disque :"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Différencier majuscules et minuscules (i.e. A et a)"
#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Editeur de documentation"
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s n'existe pas: %s"
#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "Ne pas fermer l'EDI"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Ne pas fermer le projet "
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "Ne pas compiler les dépendances"
#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr ""
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Ne pas afficher le splashscreen"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Ne plus montrer ce message."
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Dessiner les lignes de la grille"
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copier les composants sélectionnés vers le presse-papier"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Couper les composants sélectionnés vers le presse-papiers"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Déplacer le composant vers l'arrière de un niveau"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Déplacer le composant vers l'avant de un niveau"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Déplacer le composant à l'arrière"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Déplacer le composant à l'avant"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Coller les composants sélectionnés depuis le presse-papiers"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Sélectionner composant parent"
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr " Reproduction trouvée de la valeur %s%s%s."
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Nom double : Un composant appelé %s%s%s existe déjà dans le composant hérité %s"
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr ""
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Editer le contexte d'aide"
#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Choix global"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Tous les paquets"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Projet courant"
#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Répertoire du projet courant"
#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Chemin complémentaire de sources globales"
#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Chemin des fichier inc du projet"
#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Chemin des sources du projet"
#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Chemin des unités du projet"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Tous les projets"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "Mettre FPC en mode DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "Mettre FPC en mode FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "Mettre FPC en mode GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "Mettre FPC en mode MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "Mettre FPC en mode TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "Activer IOCHECKS"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Activer OVERFLOWCHECKS"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Activer RANGECHECKS"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "utiliser l'unité HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "utiliser l'unité LineInfo"
#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Un outil a besoin au minimum d'un titre et d'un nom de fichier."
#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Editer les outils"
#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr ""
#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Insérer"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Touche"
#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Paramètres :"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Fichier du programme"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Rechercher les messages de sortie de FPC"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Rechercher les message Make de sortie"
#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titre et nom de fichier requis"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Répertoire de travail:"
#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Tout"
#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Méthodes vides"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Trouvé les méthodes vide :"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Publié seulement"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Publique"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Publiée"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Supprimer les méthodes"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Rechercher dans ces classes :"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vide"
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Activer tout"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Activer tout dans la même source"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Activer le point d'arrêt"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Permis "
#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr "Activer le groupe"
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr ""
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Permettre les macros"
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Entourer"
#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr "Entourer la sélection"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Encodage du fichier %s%s%s%s sur disque est %s. Le nouvel encodage est %s."
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Encodage du fichier %s%s%s%s sur disque est %s. Le nouvel encodage est %s."
#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Entrez la langue de traduction"
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "variable d'environnement, nom comme paramètre"
#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Saut de la fenêtre de message à la ligne du code source sur un double clic(autrement: un simple clic)"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Répertoire non trouvé"
#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "Répertoire des sources de FPC \"%s\" non trouvé."
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Nom de fichier compilateur invalide"
#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Le compilateur \"%s\" n'est pas un exécutable."
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nom de débogueur invalide"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Le débogueur \"%s\" n'est pas un exécutable."
#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Le répertoire source de FPC \"%s\" ne semble pas correct. Normalement il contient des répertoires comme rtl/inc, packages/fcl-base, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Le répertoire Lazarus '\"%s\" semble incorrect. Il contient normalement des répertoires comme lcl, debugger, designer, components, ... ."
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Nom de fichier 'make' non valide"
#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Le fichier 'make' '%s' n'est pas un exécutable."
#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Répertoire de Lazarus \"%s\" non trouvé"
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Répertoire de test \"%s\" non trouvé."
#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "NOTE : seulement des chemins absolus sont supportés maintenant"
#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Largeur de tabulation"
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Option non valide à la position %d : \"%s \""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "L'option à la position %d ne permet pas un argument : %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "L'option à la position %d a besoin d'un argument : %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Erreur :"
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Erreur à la création du fichier"
#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Erreur à la création du fichier lrs"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Erreur à la suppression de fichier"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Erreur dans %s"
#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Erreur à l'initialisation du programme %s%s%s%s%sErreur : %s"
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Erreur lors du chargement du fichier"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Erreur de chargement %s depuis %s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Erreur en déplaçant le composant"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Erreur en déplaçant le composant %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Erreur en nommant le composant"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Erreur d'ouverture du composant"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Erreur d'analyse du flux de composant lfm."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Erreur en lisant la liste des paquets du fichier %s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Erreur de lecture XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Erreur de lecture du fichier XML %s%s%s%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Erreur en renommant le fichier"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Erreurs"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Erreur d'enregistrement %s dans%s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr ""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Erreur lors de l'écriture de la liste des paquets dans le fichier%s%s%s%s"
#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Editer les analyseurs personnalisés(%s)"
#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr "Evaluer l' expression"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "É&valuer"
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Chaque n-ième numéro de ligne :"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "fichier Exemple:"
#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Exemples"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Exemples:%sIdentificateur%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Notification d'exception du debogueur"
#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Filtre d'exclusion"
#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "Filtre d'exclusion"
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Exécuter la commande suivante"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Exécuter la commande précédente"
#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Exécution suspendue"
#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s Address: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Exécution suspendue%s Adresse : $%s%s Procédure : %s%s Fichier : %s%s(un jour une fenêtre d'assembleur pourrait apparaître ici :))%s"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Exécution interrompue"
#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programmes"
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Développer toutes les classes"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Développer tous les paquets"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Développer toutes les unités"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nom étendu du fichier de l'éditeur courant"
#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Exporter ..."
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Liste d'export"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Expression :"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Etendre le chemin d'unité ?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extraire"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Extraire procédure"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Outils externes"
#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "L'exécution de l'outil a échoué"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Nombre maximum d'outils atteint"
#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Bas"
#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Haut"
#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Retirer"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Le nombre d'outils est limité à %s."
#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "\"%s\" terminé"
#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Impossible d'exécuter l'outil %s%s%s:%s%s"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
#, fuzzy
msgid "Failed to load fold state"
msgstr "Le paquet suivant n'a pu être chargé :"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Réduire le traçage du designer"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Dessiner les éléments du designer seulement quand inactif (réduit la charge sur ordinateurs lents)"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Le fichier %s%s%s n'a pas l'air d'un fichier texte.%sL'ouvrir quand même ?"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Le fichier %s%s%s n'a pas l'air d'un fichier texte.%sL'ouvrir quand même ?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Extension de fichier des programmes"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtre fichier"
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Le fichier %s%s%s a été modifié. L'enregistrer ?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Le fichier n'a pas de projet"
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Fichier protégé en écriture"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Le fichier est un lien symbolique"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Le fichier %s%s%s est virtuel."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Erreur de fichier lien"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Nom de fichier/Adresse"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Fichier non trouvé"
#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Fichier %s%s%s non trouvé.%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Fichier %s%s%s non trouvé.%sSouhaitez-vous le créer ?%s"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Fichier pas en minuscules"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Pas un fichier texte"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "paramêtres fichiers"
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Fichiers encodé ASCII ou UTF-8"
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Fichiers non encodé ASCII ou UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "Où est écrit le fichier de déboguage. Si on ne l'indique pas, la sortie de déboguage est écrit sur la console. "
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtre"
#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(Filtre)"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr ""
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Jeu de filtres"
#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Sensible à la casse"
#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Options du répertoire"
#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Filtre de fichier (*;*.*;*.bak?)"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Inclure les sous-répertoires"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Modèle &Multi-ligne"
#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Seulement les fichiers texte"
#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Expressions régulières"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Rechercher dans tous les fichiers du &projet"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Rechercher dans tous les fichiers &ouverts"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Rechercher dans les &répertoires"
#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Texte à trouver :"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Ou"
#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "&Mots entiers seulement"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Trouver la combinaison de touches"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Trouver l'unité manquante"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Premier"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Corriger fichier LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Virgule flottante"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forcer le renommage"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Fiche"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Erreur de format"
#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Erreur au chargement de la fiche"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "Fpcmake échoué"
#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Composants"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "Resources FPC :"
#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "Erreur sur le répertoire des sources de FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC trop vieux"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Version FPC :"
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Version FPC (ex. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editeur FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr ""
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr ""
#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Rechercher la palette des composants"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Cadre"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Recherche en arrière"
#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"
#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Compilateur Free Pascal introuvable"
#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#, fuzzy
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Programme freepascal employant TCustomApplication pour vérifier facilement les options en ligne de commande, manipulation des exceptions, etc. Le fichier de programme est automatiquement maintenu par Lazarus."
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Répertoire des sources FreePascal"
#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Fichier source FreePascal"
#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Sources Free Pascal introuvables"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Recherche vers l'&avant"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Fichiers additionnels à chercher (ex. /chemin/*.pas;/chemin2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Trouver ou renommer l'identificateur"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Trouver les références"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identificateur : %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "dans tous les paquets et projets ouverts"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "dans l'unité courante"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "dans le projet principal"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "dans le projet/paquet possédant l'unité courante"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificateur non valide"
#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Renommer"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Renommer toutes les références"
#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Renommer en"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Chercher aussi dans les commentaires"
#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Chercher où"
#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "Fonction"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "obtient le mot à la position du curseur courante"
#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr "Aller à la ligne"
#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Aller à la ligne du source sélectionnée"
#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Groupe"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Agrandir au plus grand"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "a une aide"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Commentaire d'en-tête pour la classe"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Aide entrées"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Sélecteur d'aide"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Hexadécimal"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Aide pour les messages du compilateur FreePascal"
#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Suggestion : Vérifier si deux paquets contiennent une unité du même nom."
#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "Astuce: double-cliquez sur la commande que vous souhaitez modifier"
#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Ouvrir"
#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "Pause"
#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Exécuter"
#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "Enregistrer"
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Tout enregistrer"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Pas à pas approfondi"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Execute jusqu'au retour de fonction"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Pas à pas"
#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Arrêter"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Conseil : la fonction \"Make Ressourcestring\" s'attend à une constante chaîne.%sVeuillez choisir l'expression et réessayer."
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Conseil : la fonction \"Make Ressourcestring\" attend une constante chaîne.%sVeuillez choisir seulement une expression de type chaîne et réessayer."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Commutation Fiche/Unité"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Afficher les Fiches"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Afficher les Unités"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr ""
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Bases de données"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Options de l'aide"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Propriétés:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualiseurs"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Chemin FPC Doc HTML"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontal"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "EDI"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Options de construction de l'IDE"
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr ""
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr ""
#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "Interface EDI"
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Identificateur"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "L'identificateur commence par..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "L'dentificateur contient ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Options de l'EDI :"
#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "Voir le répertoire du projet dans le titre de l'IDE"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Le titre de l'IDE débute avec le nom du projet"
#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "Erreur d'accès xml"
#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Erreur d'accès au fichier xml %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "Erreur de chargement xml"
#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Erreur de chargement du fichier xml %s%s%s:%s%s"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Le fichier d'export existe"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Le fichier d'export %s%s%s existe.%sOuvrir le fichier et remplacer seulement les options du compilateur?%s(les autres paramètres seront conservés.)"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Charger depuis un fichier"
#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Ouvrir ou charger les options du compilateur"
#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Ouverture récente"
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Fichiers récents"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Enregistrer dans un fichier"
#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Enregistrer dans un fichier récent"
#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorer tout"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorer et continuer"
#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Ignorer les binaires"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorer ce type d'exception"
#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Ignorer le fichier manquant"
#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Ignorer, employer TForm comme ancêtre "
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Imite l'indentation de l'unité, du projet ou du paquet en cours"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Commentaire d'implémentation pour la classe"
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Liste d'import"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossible"
#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Inclure le filtre"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "chemin 'include'"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Inclure les chemins"
#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "Indentation"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "Indentation des sources en pascal"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Index"
#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr "Abandonner..."
#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Compiler le projet"
#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "Compilation ..."
#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr "Erreur..."
#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Erreurs :"
#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Conseils :"
#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Lignes :"
#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Abandon"
#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Notes :"
#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Projet:"
#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "Succès..."
#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Avertissements"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Information"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informations sur %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr ""
#: lazarusidestrconsts.lisinfrontofrelated
#, fuzzy
msgid "In front of related"
msgstr "Devant les méthodes"
#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr "Composant hérité"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Élément hérité"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Afin de créer une copie prope du projet/paquet, tous les fichiers dans le répertoire suivant seront supprimés et tout son contenu sera perdu.%s%sSupprimer tous les fichiers dans %s%s%s ?"
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Insérer date"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Insérer date et heure"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Insérer la date et l'heure. Facultatif: format chaîne de caractère"
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Insérer la date. Facultatif: format chaîne de caractère"
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Insère end si nécessaire"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Insérer une macro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Insére le nom de la procédure courante"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "insère la balise PrintShort"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Insère la balise printshort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Insère un entête de procédure"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Insérer un nom de procédure"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "Insérer l'heure"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
#, fuzzy
msgid "Insert time. Optional: format string"
msgstr "Insérer la date. Facultatif: format chaîne de caractère"
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Insérer une balise url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Inspecter"
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Données"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Inspecteur de débogage"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Méthodes"
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Propriétés "
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Installation ratée"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installer la sélection"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr ""
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr ""
#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr ""
#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr ""
#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "Cercle invalide"
#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Commande non valide"
#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Nom de compilateur non valide"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Effacement non valide"
#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Répertoire de destination non valide"
#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Expression non valide :%s%s%s%s"
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Expression non valide.%sConseil: la fonction \"Make Resourcestring\" s'attend à une constante de type chaîne dans un fichier unique. Veuillez choisir l'expression et réessayer."
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtre non valide"
#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Répertoire source Free Pascal non valide"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr ""
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Sélection multiple non valide"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Invalide (Off)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Invalide (On)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificateur Pascal invalide"
#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Le nom \"%s\" n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Nom de procédure non valide"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nom de fichier projet non valide"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Répertoire de publication non valide"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Sélection non valide"
#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr ""
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s fait déjà partie du projet"
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s n'est pas un nom de projet valide.%sVeuillez en choisir un autre (ex: project1.lpi)"
#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s est %s.%s Ce cercle de dépendance n'est pas autorisé."
#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr "Historique des déplacements"
#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "Fiche JIT"
#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "garder"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr ""
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr ""
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Préserver le nom"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Préserver et continuer"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Commandes personnalisées"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Commandes du concepteur"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Commandes de l'inspecteur d'objets"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Touche (ou séquence de 2 touches)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Arrêter la construction"
#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Ajouter l'unité active au projet"
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Ajouter un suivi"
#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Construire tous les fichiers du projet/programme"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Construire le programme/projet"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Choisir l'arrangement du clavier"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Classique"
#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Fermer tout"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Fermer le projet"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editeur des directives des outils de code ..."
#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "Options des outils de code"
#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Options du compilateur"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "Configurer %sConstruire le fichier%s"
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Configurer les composants personnalisés ..."
#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Configurer l'aide "
#: lazarusidestrconsts.liskmconfigureinstalledpackages
#, fuzzy
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Configurer les paquets installés"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Aide contextuelle"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Convertir un paquet Delphi en paquet Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Convertir un projet Delphi en projet Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Convertir une unité Delphi en unité Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "Convertir un fichier DFM vers LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Copier les composants choisis vers le presse-papier"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Couper les composants choisis vers le presse-papiers"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Effacer le dernier caractère"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Editeur de différences "
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Editer les modèles de code"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Éditer l'aide contextuelle"
#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Options de l'éditeur"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Entourer la sélection"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Evaluer/modifier "
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Configuration d'outils externes "
#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Recherche incrémentale"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Aller au marqueur 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Aller au marqueur 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Aller au marqueur 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Aller au marqueur 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Aller au marqueur 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Aller au marqueur 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Aller au marqueur 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Aller au marqueur 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Aller au marqueur 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Aller au marqueur 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Aller à éditeur de source 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Aller à éditeur de source 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Aller à éditeur de source 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Aller à éditeur de source 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Aller à éditeur de source 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Aller à éditeur de source 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Aller à éditeur de source 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Aller à éditeur de source 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Aller à éditeur de source 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Aller à éditeur de source 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Insérer la date et l'heure"
#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "Insérer $IFDEF..."
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Insérer le nom d'utilisateur"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecter"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Modèle de clavier"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (défaut)"
#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "Mac OS X (Apple style)"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "Mac OS X (Lazarus style)"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nouveau paquet"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nouveau projet"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nouveau projet depuis le fichier"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nouvelle unité"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Note: toutes les touches seront définies avec les valeurs du programme choisi"
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Ouvrir un fichier paquet"
#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "Graphique des paquets"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Coller les composants depuis le presse-papiers"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "suspendre le programme"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publier le projet ..."
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compiler vite, aucun liens"
#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Retirer l'unité active du projet"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Exécuter un programme"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Enregistrer tout"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Enregistrer sous"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Enregistrer le projet"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Enregistrer le projet sous"
#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Sélectionner fin de ligne"
#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Sélectionner début de ligne"
#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Sélectionner bas de page"
#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Sélectionner haut de page"
#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Sélectionner mot de gauche"
#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Sélectionner mot de droite"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Mettre un signet libre"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Placer le marqueur 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Placer le marqueur 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Placer le marqueur 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Placer le marqueur 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Placer le marqueur 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Placer le marqueur 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Placer le marqueur 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Placer le marqueur 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Placer le marqueur 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Placer le marqueur 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Arrêter le programme"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Commuter entre l'unité et la fiche"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Placer le marqueur 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Placer le marqueur 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Placer le marqueur 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Placer le marqueur 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Placer le marqueur 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Placer le marqueur 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Placer le marqueur 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Placer le marqueur 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Placer le marqueur 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Placer le marqueur 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr "Commuter vue assembleur"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Commuter vue Point d'arrêt"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Commuter vue Pile d'appels"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Commuter vue Explorateur de code"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Commuter vue Palette de composants"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "Toggle view Debuger Event Log"
msgstr "Basculer la vue vers le journal d'événement du débogueur"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Commuter vue Sortie du débogueur"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Commuter vue Editeur de documentation"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Commuter vue boutons rapides EDI"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Commuter vue Variables Locales"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Commuter vue Messages"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Commuter vue Inspecteur d'objets"
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr "Commuter sur la vuedes registres"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Commuter vue Résultats de recherche"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Commuter vue Editeur de source"
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Commuter vue Suivi"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Afficher l'historique des déplacements ..."
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Afficher les options du projet"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Afficher les sources du projet"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Afficher les Infos d'Unité"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Lancement de l'application non valide"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Lancement de la cible avec la ligne de commande"
#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Paramêtres du bureau Lazarus"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Répertoire de Lazarus"
#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Répertoire de Lazarus introuvable"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "répertoire, à utiliser comme un répertoire de base"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "EDI Lazarus v%s"
#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "Fichier Lazarus"
#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "fiche Lazarus"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "EDI Lazarus"
#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Fichier d'inclusion Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Identificateur de langue de Lazarus (par exemple en, de, br, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nom de langue de Lazarus (par exemple english, deutsch)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [options] <ficher-projet>"
#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "paquet Lazarus"
#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "projet Lazarus"
#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "fichier d'information du projet Lazarus"
#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "source du projet Lazarus"
#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "unité Lazarus"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Action"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Choisissez le répertoire de sortie pour l'exécutable de l'EDI"
#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "Partie"
#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Ajouter"
#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Options de construction avancées"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Construire"
#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr ""
#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Construire les outils de code"
#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Construire les composants (SynEdit, CodeTools)"
#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "Construire les exemples"
#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "Construire l'EDI"
#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "Construire la JITForm"
#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Construire SynEdit"
#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Nettoyer tout"
#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Nettoyer+Construire"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr ""
#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr ""
#: lazarusidestrconsts.lislazbuildconfirmbuild
#, fuzzy
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "Confirmer avant de reconstruire Lazarus"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr ""
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr ""
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Erreur d'écriture de fichier"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild n'est pas interactif, abandoner maintenant."
#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr ""
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""
#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Aucun"
#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "OK"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Options :"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr ""
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr ""
#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr "Construire tout"
#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "Construire l'EDI sans les paquets"
#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "Construire l'EDI avec les paquets"
#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "Construire la LCL"
#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Nettoyer + construire tout"
#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Rafraîchir"
#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Retirer"
#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Renommer"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr ""
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr ""
#: lazarusidestrconsts.lislazbuildrestartafterbuild
#, fuzzy
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "Redémarrer après une construction réussie"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr ""
#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Enregistrer la configuration"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr ""
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr ""
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU de destination"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Répertoire cible :"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "OS de destination :"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Impossible d'écrire le fichier \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr ""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr ""
#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr "Avec paquets"
#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"
#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Chemin de l'unité LCL manquant"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "Type composant graphique LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Ajouter un lien à hérité"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copie depuis hérité "
#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s ne dispose d'aucun chemin d'accès LazDoc valide.%sImpossible de créer le fichier pour %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Déplacer les entrées vers hérité"
#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Chemin LazDoc non valide"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "L'unité %s n'appartient à aucun paquet ou projet. %sVeuillez ajouter l'unité à un paquet ou à un projet. %s Impossible de créer le fichier fpdoc."
#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Laissez vide pour le fichier .po par défaut"
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Gauche"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "L'espace de bordure gauche. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à gauche du contrôle."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancrage à gauche"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "C'est le contrôle à laquelle le côté gauche est ancré. Laisser vide pour le parent."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Côtés gauches"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Espacement gauche égal"
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Niveaux"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Fichier LFM"
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Fichier LFM corrompu"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM est ok"
#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Bibliothèque%sune bibliothèque freepascal (.dll sous windows, .so sous linux, .dylib sous macosx). Le fichier source de la bibliothèque est automatiquement maintenu par Lazarus."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "Chemin des librairies"
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Ligne :"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Ligne/longueur"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Lien :"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "options de l'éditeur de liens"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Lier la cible"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr " liste de toutes les valeurs de cas"
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Le chargement de%s a échoué."
#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Locales"
#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Nom"
#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Valeur"
#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr "Journal des messages"
#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Logo"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "chaîne en minuscules"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "chaîne de caractère en minuscules donnée en paramètre"
#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "montre le point d'exécution"
#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac Pascal"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr ""
#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr ""
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Entrez les données"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Entrez les paramètres d'exécution"
#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr ""
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "L'unité principale a des instructions Application.CreateForm"
#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "L'unité principale a des instructions Application.Title"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "L'unité principale a une section Uses contenant toutes les unités du projet"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "L'unité principale est un source Pascal"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Créer un exécutable"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "'Make' introuvable"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Construire une chaîne ressource"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Ajouter à la section"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "La chaîne ressource %s%s%s existe déjà %sVeuillez choisir un autre nom.%sUtilisez Ignorer pour l'ajouter quand même."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Options de conversion"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificateur personnalisé"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificateur"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Longueur d'identificateur :"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Préfixe de l'identificateur :"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Insérer par ordre alphabétique"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Insérer en tenant compte du contexte"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Section ResourceString non valide"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "S’il vous plaît choisisser une section Resourcestring de la liste."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Resourcestring existe déjà"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Section Resourcestring :"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Prévisualisation du code source"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Constante chaîne dans le source"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Chaînes avec la même valeur:"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Max %d"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Vidage Mémoire"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Arrêter la construction"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr ""
#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Point d'arrêt source"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Ajouter un point d'arrêt"
#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Ajouter l'unité active au projet"
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Ajouter un point de saut à l'historique"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Ajouter le fichier de l'éditeur au projet"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Ajouter un suivi ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Couper les lignes dans la sélection"
#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Construire"
#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Construire tout"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Construire le fichier"
#: lazarusidestrconsts.lismenubuildlazarus
#, fuzzy
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "Construire Lazarus"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr ""
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "Vérifier le fichier LFM dans l'éditeur"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Nettoyer un répertoire ..."
#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Fermer"
#: lazarusidestrconsts.lismenucloseall
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Fermer tous les fichiers de l'édituer"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Fermer le projet"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Editeur des directives des outils de code ..."
#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr "Collecter les fichiers .po"
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Commenter la sélection"
#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Options du compilateur ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Compléter le code"
#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "Insérer $IFDEF..."
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configurer Construire+Exécuter le fichier ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Configurer les composants personnalisés ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Configurer des outils externes..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configurer \"Build Lazarus\" ..."
#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Configurer l'aide ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Aide contextuelle"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Convertir un paquet Delphi en paquet Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Convertir un projet Delphi en projet Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Convertir une unité Delphi en unité Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "Convertir un fichier binaire DFM en un fichier texte LFM et vérification de syntaxe ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Convertir le codage de projets/paquets..."
#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Copier"
#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "Créer un fichier FPDoc"
#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Créer les fichiers .po"
#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Couper"
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Fenêtres de débogage"
#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Différences"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editer"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Modèles de code ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Éditer l'aide contextuelle"
#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Configurer les paquets installés ..."
#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr "Editeur de menu..."
#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Créer un sous-menu"
#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Supprimer du modèle ..."
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Supprimer l'élément"
#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Gérer l'événement OnClick"
#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Insérer depuis le modèle ..."
#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Insérer un nouvel élément (après)"
#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Insérer un nouvel élément (avant)"
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editeur de menu"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Déplacer vers le bas (ou à droite)"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Déplacer vers le haut (ou gauche)"
#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Nouvelle description de modèle..."
#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Enregister comme modèle..."
#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Menu sélectionner:"
#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Choisir le modèle:"
#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Prévisualisation d'un modèle"
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Entourer la sélection ..."
#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Confi&guration"
#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Evaluer/Modifier ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Extraire procédure ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Fichier"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Chercher"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Chercher"
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Chercher l'autre extrémité du bloc de code"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Chercher le début du bloc de code"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Rechercher la déclaration sous le curseur"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Trouver les références de l'identificateur ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "Chercher dans les &fichiers ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Chercher l'occurrence &suivante"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Chercher l'occurrence &précédente"
#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "Editeur FPDoc"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Options..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Aller à la directive \"Include\""
#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Aller à la ligne ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Deviner les IFDEF/ENDIF mal placés"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Deviner les blocs non terminés"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Aide"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "dessous de l'EDI"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Recherche incrémentale"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Indenter la sélection"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Entrée ChangeLog"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Insérer depuis la table des caractères"
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "Mot-clé CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Date et heure courantes"
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Général"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "Notice GPL"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "Notice LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Notice modifié LGPL"
#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Insérer un texte"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Utilisateur courant"
#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Inspecter..."
#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "En arrière"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "En avant"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Aller à"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Aller au signet suivant"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Erreur suivante"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Aller au signet précédent"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Erreur précédente"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Mettre la sélection en minuscules"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Construire une chaîne ressource ..."
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nouvelle fiche"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nouveau..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Nouveau paquet ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nouveau projet ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Nouveau projet depuis le fichier ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nouvelle unité"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Aide en ligne"
#: lazarusidestrconsts.lismenuopen
#| msgid "Open ..."
msgid "&Open ..."
msgstr "&Ouvrir"
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Ouvrir le fichier sous le curseur"
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Ouvrir le paquet chargé ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Ouvrir un fichier paquet (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Ouvrir le paquet de l'unité courante"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Ouvrir un projet ..."
#: lazarusidestrconsts.lismenuopenrecent
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "&Récemment ouverts"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Ouvrir un paquet récent ..."
#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Réouvrir un projet ..."
#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "Pa&quet"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Graphe des paquets ..."
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "Liens Paquet ..."
#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Coller"
#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Pause"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Liste de procédure ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projet"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspecteur de projet"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Options du projet ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Exécuter"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publier le projet ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Construire vite "
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Vérification rapide de la syntaxe"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "vérification rapide de la syntaxe"
#: lazarusidestrconsts.lismenuquit
#| msgid "Quit"
msgid "&Quit"
msgstr "&Quitter"
#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Refaire"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Retirer du projet ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Renommer l'identificateur ..."
#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Remplacer"
#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "&Remplacer"
#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "Signaler un bogue ..."
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "Reparcourir le répertoire des sources FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Réinitialiser le débogueur"
#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Redémarrer"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Restaurer"
#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "E&xécuter"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Exécuter le fichier"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Paramètres d'exécution..."
#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Exécuter jusqu'au curseur"
#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Enregistrer"
#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Tout enregistrer"
#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Enregistrer &sous..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Enregistrer le projet"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Enregistrer le projet sous ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Chercher"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Sélectionner"
#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Tout sélectionner"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Sélectionner le bloc de code"
#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Sélectionner la ligne"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Sélectionner paragraphe"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Ancrer la sélection"
#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Sélectionner un mot"
#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Mettre un signet libre"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr "montre le point d'exécution"
#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Trier la sélection ..."
#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Pas à pas approfondi"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepout
#, fuzzy
msgid "Step out"
msgstr "Pas à pas approfondi"
#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Pas à pas"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr ""
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr ""
#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Arrêter"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Remplacer les tabulations par des espaces dans la sélection"
#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "A propos"
#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Fermer"
#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Contenu"
#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Copier"
#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Couper"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Menu Edition standard"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Menu Fichier standard"
#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Menu Aide standard"
#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Editer"
#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Quitter"
#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Fichier"
#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Chercher"
#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Trouver l'occurence suivante"
#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Aide"
#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Nouveau"
#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Ouvrir"
#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Réouvrir"
#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Coller"
#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Refaire"
#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Enregistrer"
#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Enregistrer sous"
#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Tutorial"
#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "Défaire"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr "Commuter vers les commentaires"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Outils"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Décommenter la sélection"
#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Défaire"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Désindenter la sélection"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Mettre la sélection en majuscules"
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Voir"
#: lazarusidestrconsts.lismenuviewanchoreditor
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Editeur d'ancres"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembleur"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Points d'arrêts"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Pile d'appels"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Navigateur de code"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"
#: lazarusidestrconsts.lismenuviewcomponentpalette
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Palette de composants"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Composants"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Journal des événements"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Sortie de débogueur"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Fiches ..."
#: lazarusidestrconsts.lismenuviewidespeedbuttons
#, fuzzy
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Afficher les boutons rapides de l'EDI"
#: lazarusidestrconsts.lismenuviewjumphistory
#| msgid "View Jump-History ..."
msgid "Jump History ..."
msgstr "Historique des déplacements ..."
#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Variables locales"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Messages"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspecteur d'objets"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registres"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Explorateur de restrictions"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Résultats de la recherche"
#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "&Afficher le source"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editeur de source"
#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Liste ToDo"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Commutation Fiche/Unité"
#: lazarusidestrconsts.lismenuviewunitdependencies
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Dépendances de l'unité"
#: lazarusidestrconsts.lismenuviewunitinfo
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Informations sur l'unité"
#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Unités ..."
#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Points de suivi"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Fe&nêtre "
#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editeur de Messages"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Classe de la méthode introuvable"
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Evènement manquants"
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificateurs manquant"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Paquets manquants"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Vos choix sont:"
#: lazarusidestrconsts.lismissingunitscomment
#, fuzzy
msgid "Comment Out"
msgstr "1) Commentaire sur les unités sélectionnées."
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Pour Delphi seulement"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Commentaire sur les unités sélectionnées."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Utiliser les unités uniquement pour Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Recherche des unités. Les chemins trouvés sont ajoutés aux paramètres du projet."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Abandonnez maintenant, installez les paquets ou de fixez les chemins et essayez à nouveau."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Recherche de chemin de l'unité"
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Modifier"
#: lazarusidestrconsts.lismore
msgid "More"
msgstr "Plus"
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr ""
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr ""
#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "Déplacer la page..."
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Sauver les messages dans un fichier (*.txt)"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflit de nom"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nom de la nouvelle procédure"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Jamais"
#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "Nouveau"
#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Nouveaux ancêtres"
#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "Nouveau mode construction"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nouvelle classe"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nouvelle application console"
#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
#| msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "Créer une nouvelle application CGI.%sLa source de l'application est gérée par Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Créer un nouveau programme."
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Créer un nouveau fichier dans l'éditeur.%sChoisir un type."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Créer un nouveau fichier texte vide"
#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Créer une nouvelle application graphique.%sLa source de l'application est gérée par Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Créer une nouvelle unité Pascal."
#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Créer un nouveau programme.%sLa source de l'application est gérée par Lazarus."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Créer un nouveau projet.%Choisir un type."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Créer un nouveau paquet standard.%sUn paquet est une collection d'unités et de composants."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Créer une nouvelle unité avec un module de données."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "Créer une nouvelle unité avec un cadre."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Créer une nouvelle unité avec une fiche LCL."
#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "Hériter d'un composant existant."
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Pas d'élément sélectionné"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Veuillez d'abord sélectionner un élément"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nouveau codage :"
#: lazarusidestrconsts.lisnewgroupasetofmodes
#, fuzzy
msgid "New group - a set of modes"
msgstr "Confirmez le nouvel ensemble de paquets pour l'EDI"
#: lazarusidestrconsts.lisnewproject
#, fuzzy
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "%s - (nouveau projet)"
#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "Nouveau paramètre"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr "De nouvelles unités sont ajoutées aux sections uses:"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Non"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Pas de fichiers de sauvegarde"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr ""
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Pas de changements"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Aucun code sélectionné"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Aucune option de compilateur héritée"
#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr ""
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "pas de conseil"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Pas de fenêtre iDE sélectionné"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "pas de fichier LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr ""
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "sans_nom"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%s aucun "
#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "Aucun"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "Aucun nœud sélectionné"
#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "pas de fichier pascal"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Fichier programme %s%s%s non trouvé."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Section ResourceString non trouvée"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalement le filtre est une expression régulière. En syntaxe simple un . est un caractère normal, une * vaut pour toute suite de caractères , un ? vaut pour tout caractère, et la virgule et le point-virgule sépare les solutions de rechange . Par exemple : Syntaxe simple *.pas;*.pp correspond à ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Constante chaîne non trouvée"
#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Pas un projet Delphi"
#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Pas une unité Delphi"
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "N'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOTE : Incapable de créer le modèle 'Define' pour sources Lazarus"
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Non implémenté"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Non implémenté à ce jour :%s%s"
#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Non implémenté à ce jour."
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Pas maintenant"
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Créer"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Créer un nouveau projet"
#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Choisir un type de projet"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Nombre de fichiers à convertir:%s"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Pascal Objet - default"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "Chemin du code objet"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Basculer vers l'onglet des favoris de l'inspecteur d'objet"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Bascule vers l'onglet des favoris de l'inspecteur d'objet après avoir demandé le nom du composant"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Off)"
#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Ajouter aux propriétés favorites"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Choisir une classe de base pour la propriété favorite %s%s%s."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Classe %s%s%s non trouvée."
#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Retirer des propriétés favorites"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "Installation auto dynamique"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "Installation auto statique"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Description : "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sDescription : %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Nom de fichier : %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "installé dynamiquement"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "installé statiquement"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "manquant"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modifié"
#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Pas de paquet sélectionné"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Ouvrir le paquet chargé"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nom du paquet"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Veuillez sélectionner un paquet"
#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Veuillez sélectionner un paquet à ouvrir"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "Lecture seule"
#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Etat"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%s Ce paquet est installé, mais le fichier lpk est introuvable"
#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sCe paquet a été créé automatiquement"
#: lazarusidestrconsts.lisok
#| msgid "&Ok"
msgid "&OK"
msgstr "&OK"
#: lazarusidestrconsts.lisold
msgid "old"
msgstr "Ancien"
#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Anciens ancêtres"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Ancienne classe"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (On)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Sur le saut de ligne (à savoir tourche RETURN ou ENTER)"
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Chercher les mots entiers seulement"
#: lazarusidestrconsts.lisonpastefromclipboard
#, fuzzy
msgid "On paste from clipboard"
msgstr "Coller les composants depuis le presse-papiers"
#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr ""
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Ouvrir un fichier XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Ouvrir le concepteur de fiche avec l'unité ouverte"
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Ouvrir le fichier existant"
#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Ouvrir un fichier"
#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "Ouvrir un fichier..."
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Ouvrir %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Ouvrir le paquet ?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Ouvrir le paquet %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Ouvrir un fichier paquet"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Ouvrir le projet ?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Ouvrir projet"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Réouvrir projet"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Ouvrir un fichier projet"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Ouvrir le lien symbolique"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Ouvrir la cible"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Ouvrir le fichier en tant que source normale"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Ouvrir le paquet %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Ouvrir le projet %s?"
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "ou"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Outrepasser le langage. Par exemple --language=de. Pour les valeurs possibles voir dans le dossier languages."
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sredefinie le compilateur par défaut. par exemple, ppc386 ppcx64 ppcppc etc par défaut est stocké dans environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr ""
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sredefinie la CPU du projet. Par exemple, i386 x86_64 powerpc powerpc_64 etc. défaut: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sredefinie l'OS du projet. Par exemple, win32 linux. défaut: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sredefinie le widgetset du projet. Par exemple, gtk gtk2 qt win32 carbon. défaut: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Ecraser le fichier ?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Ecraser les fichiers sur le disque"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr ""
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paquet"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr " paquet %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Information paquet"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Le nom de paquet commence par ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Nom de paquet contient ..."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Le paquet doit être installé"
#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Paquets à installer dans l'EDI"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "Unité du paquet"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""
#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Fichier source pascal"
#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Unité pascal"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Nombre de passes"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Coller le contenu du presse-papiers"
#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Coller le texte depuis le presse-papiers"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Chemin"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Parcourir"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Descendre le chemin"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Monter le Chemin"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Chemin des modèles"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Chemins de recherche:"
#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Sélectionner un répertoire"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Chemin de l'utilitaire make"
#: lazarusidestrconsts.lispathtoinstance
#, fuzzy
msgid "Path to failed Instance:"
msgstr "L'exécution de l'outil a échoué"
#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Ajouter un élément"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "Ajouter au projet"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Appliquer les changements"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Appel de la procédure %sRegister%s de l'unité sélectionnée"
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Effacer le nom de fichier de dépendance par défaut/préféré"
#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Compiler"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Compiler tout?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compiler le paquet"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Options du compilateur pour le paquet %s"
#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Options du compilateur"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Créer le Makefile"
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, defaut: %s"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Propriétés de dépendance"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Editer les options générales"
#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Editer les options de compilation de paquet"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Propriétés du fichier"
#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Options générales"
#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Aide"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installer"
#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Installer le paquet dans l'EDI"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Version maximum non valide"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Version minimum non valide"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Version maximum :"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Version minimum :"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Modifié : %s"
#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Plus ..."
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Déplacer la dépendance vers le bas"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Déplacer la dépendance vers le haut"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Paquet %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Le paquet %s%s%s a changé.%sL'enregistrer ?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "paquet %s non enregistré"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Page : %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Ré-ajouter la dépendance"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Ré-ajouter le fichier"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Lecture seule: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Recompiler tout ce qui est requis"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Nettoyer et recompiler"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Re-compiler ceci et tous les paquets requis ?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Référencer les plugins"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Référencer l'unité"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Retirer la dépendance"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Retirer la dépendance ?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Retirer la dépendance %s%s%s%sdu paquet %s%s%s ?"
#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Fichiers retirés (ces entrées ne sont pas enregistrées dans le fichier lpk)"
#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Les paquets requis ont été retirés (ces entrées ne sont pas enregistrées dans le fichier lpk)"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Retirer le fichier"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Retirer le fichier ?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Retirer le fichier %s%s%s%sdu paquet %s%s% ?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Retirer l'élément sélectionné"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Paquets requis"
#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Enregistrer les modifications ?"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Enregistrer le paquet"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Enregistre le nom de fichier par défaut pour cette dépendance"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Enregistre le nom de fichier en favoris pour cette dépendance"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La version maximale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La version minimale %s%s%s n'est pas une version de paquet valide.%s(exemple correct: 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Désinstaller"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Afficher le Source du Paquet"
#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "généré automatiquement"
#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Installé"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installer au prochain démarrage"
#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Le paquet sélectionné est requis par:"
#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Paquets chargés :"
#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Paquet %s non trouvé"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sEtat : "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Désinstaller au prochain démarrage"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Ajouter les options aux paquets et projets dépendants"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Ajouter les chemins aux paquets/projets dépendants"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Auteur:"
#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Incrémenter automatiquement la version à la construction"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Reconstruire automatiquement au besoin"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Reconstruction automatique quand on reconstruit tout"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personnalisé"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Description/Résumé"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Conception et exécution"
#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Conception seulement"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Intégration de l'EDI"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Inclure"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Type de paquet non valide"
#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "Chemin des fichiers FPDoc"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Librairie"
#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Licence :"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Editeur de liens"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Principal"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilation manuelle (jamais automatiquement)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Mineur"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objet"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Options du paquet"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Type de paquet"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Fournit"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Libérer"
#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "A l'éxécution seulement"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Le paquet %s%s%s est marqué pour installation automatique.%sCeci implique qu'il sera installé dans l'EDI. Les paquets d'installation%sdoivent être des paquets de conception."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Ce paquet fournit les mêmes que les paquets suivants :"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Mettre à jour/Reconstruire"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Utilisation"
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Abandon"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progrès"
#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflit trouvé "
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Editer l'unité virtuelle"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nom de fichier :"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Corriger la casse des fichiers"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nom de fichier d'unité non valide"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nom d'unité non valide"
#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Déplacez le fichier vers le bas"
#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Déplacez le fichier vers le haut"
#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "Trier les fichiers"
#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Il y a déjà une unité avec ce nom.%sFichier: %s"
#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Le nom d'unité n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Le nom d'unité est employé quand l'ide prolonge les clauses uses."
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nom d'unité:"
#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Le nom d'unité et de fichier ne doivent pas être identique. %s Example: unit1.pas and Unit1"
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Chemin de source compilé additionnel"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Répertoire de destination"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Marque de répertoire source des paquets"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Chemin de l'unité"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Voulez-vous réellement abandonner les changements sur le paquet %s et le recharger à partir du fichier ?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nouvelle unité pas dans le chemin de l'unité"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publier le paquet"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Restaurer le paquet?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Le fichier %s%s%s%s n'est pas actuellement dans le chemin des unités du paquet.%s%sAjouter %s%s%s au chemin ?"
#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Aide en ligne pas encore implémentée"
#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Cliquez-droit sur l'arbre des éléments pour ouvrir le menu contextuel avec toutes les fonctions de paquet."
#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Il y a plus de fonctions dans le menu contextuel."
#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Binaire"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Fichier inclus"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Fichier xml des problèmes"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "Fiche Lazarus texte - LFM"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "Fichier ressource Lazarus - LRS"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Unité principale"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Texte"
#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unité"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unité virtuelle"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sAjout d'une nouvelle dépendance pour le paquet %s: paquet %s%s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sAjout d'une nouvelle dépendance pour le projet %s: paquet %s%s"
#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Ajouter une unité à la clause uses du paquet. Désactivez ceci seulement pour les unités qui ne devraient pas être compilées dans tous les cas."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unités ambigües trouvées"
#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Un paquet requis n'a pas été trouvé. Voir le graphique des paquets."
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Paquets installés automatiquement"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sLes deux paquets sont connectés. Soit l'un des paquets utilise l'autre, ou les deux sont utilisés par un troisième."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dépendance brisée"
#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Dépendances circulaires dans un paquet"
#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "La suppression a échoué"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Supprimer l'ancien fichier paquet ?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Supprimer l'ancien fichier paquet %s%s%s ?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Dépendance sans Propriétaire : %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Erreur de lecture de fichier"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Erreur de lecture du paquet"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr ""
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Erreur d'écriture de fichier"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Erreur d'écriture du paquet"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Le fichier est déjà dans le paquet"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Le fichier est dans le projet"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nom de fichier différent du nom de paquet"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nom de fichier utilisé par un autre paquet"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nom de fichier utilisé par un projet"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Fichier %s%s% non trouvé."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Fichier non enregistré"
#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Ignorer et sauver le paquet maintenant "
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Intaller le paquet %s installera automatiquement le paquet :"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Installer le paquet %s installera automatiquement les paquets :"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Nom de fichier de compilateur non valide"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Extension de fichier non valide"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Extension de fichier paquet non valide"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nom de fichier paquet non valide"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nom de paquet non valide"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nom de paquet non valide"
#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Le chargement du paquet %s remplacera le paquet %s%sdu fichier %s.%sL'ancien paquet est modifié.%s%s Enregister l'ancien paquet %s ?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NouveauPaquet"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Paquet : %s"
#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Paquet %s%s%s modifié. L'enregistrer ?"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Paquet en conflit"
#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Fichier paquet manquant"
#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Fichier paquet non enregistrer"
#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Le paquet %s%s%s n'a pas de répertoire de destination valide : %s%s%s%s"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Le paquet n'est pas un paquet de conception"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Le paquet est requis"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "fichier source principal du paquet"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Nom de paquet déjà existant"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Les paquets doivent avoir l'extension .lpk"
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Veuillez enregistrer le fichier avant de l'ajouter à un paquet"
#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Veuillez d'abord sauver le paquet"
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projet: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Reconstruire Lazarus ?"
#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Renommer le fichier dans le paquet?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Renommer le fichier en minuscules ?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Remplacer le fichier existant %s%s%s ?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Remplacer le fichier"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Enregistrer le paquet ?"
#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Enregistrer le paquet?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Enregistrer le paquet %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Souhaitez-vous renommer en minuscules comme %s%s%s%s ?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Sauter ce paquet"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Fichier de configuration des paquets statiques"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Le fichier compilateur pour le paquet %s n'est pas un exécutable valide:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Le fichier %s%s%s%s est déjà dans le paquet %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Le fichier %s%s%s n'est pas un paquet Lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Le nom de fichier %s%s%s ne correspond pas au paquet nommé %s%s%s dans le fichier.%sChanger le nom du paquet par %s%s%s?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Le fichier nommé %s%s%s fait partie du projet en cours.%sLes projets et paquets ne devraient pas partager de fichiers."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Le nom de fichier %s%s%s est utilisé par%sle paquet %s%s%s%sdans le fichier %s%s%s."
#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Le fichier %s%s%s%s du paquet %s est manquant"
#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Le fichier %s%s%s%sdu paquet %s a besoin d'être sauvé d'abord."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Le paquet suivant n'a pu être chargé :"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Les paquets suivants n'ont pu être chargés :"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sL'unité suivante sera ajoutée à la liste USES de%s%s:%s%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Le paquet %s%s%s n'a pas été compilé.%sL'enlever de la liste d'installation ?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Le nom de paquet %s%s%s dans%s%s%s%s n'est pas un nom de paquet Lazarus valide."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Le paquet %s n'est qu'un paquet d'éxécution.%sLes paquets d'éxécution ne peuvent pas être installés dans l'EDI."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Le paquet %s%s%s est marqué pour l'installation mais est introuvable.%sRetirer la dépendance de la liste d'installation des paquets?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Le paquet %s est requis par %s, qui est marqué pour l'installation.%sVoir le graphe des paquets."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Le nom de paquet %s%s%s n'est pas un nom de paquet invalide.%sVeuillez choisir un autre nom (comme package1.lpk)."
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Le nom de paquet %s%s%s du%sfichier %s%s%s est invalide"
#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Le paquet %s possède le fichier%s%s%s%s.%sLe fichier doit-il être renommé dans le paquet aussi?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Le paquet %s%s%s a été marqué. %sActuellement Lazarus ne supporte que les paquets liés statiquement. La désinstallation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous reconstruire Lazarus maintenant ?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Le paquet %s%s%s a été marqué pour l'installation.%sActuellement Lazarus ne supporte que les paquets liés statiquement. L'installation nécessite de reconstruire et de redémarrer Lazarus.%s%sVoulez-vous reconstruire Lazarus maintenant ?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Le projet nécessite le paquet %s%s%s.%sMais il est introuvable. Voir Projet->Inspecteur de projet."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Deux unités portent le même nom: %s%s1. %s%s%s de %s%s2. %s%s%s de %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Il y a une dépendance circulaire dans les paquets requis. Voir le graphe des paquets."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Une unité de FPC porte le même nom que le paquet:%s%s%s%s%s%s"
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Une unité de FPC porte le même nom que:%s%s%s%s%s de %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Un autre paquet porte déjà le nom %s%s%s.%sPaquet en conflit: %s%s%s%sFichier: %s%s%s"
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Il y a déjà un paquet %s%s%s chargé%sdepuis le fichier %s%s%s.%sVoir Composants -> Graphe des paquets%sRemplacer est impossible"
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Il y a un paquet non enregistré dans les paquets requis. Voir le graphe des paquets."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Une unité porte le même nom qu'un paquet:%s%s1. %s%s%s de %s%s2. %s%s%s%s"
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "C'est un paquet virtuel. Il n'a pas encore de source. Veuillez sauvegarder le paquet d'abord."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Impossible de créer le répertoire"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Impossible de créer le répertoire de destination %s%s%s%s pour le paquet %s"
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Impossible de créer le répertoire %s%s%s%spour les sources du paquet %s"
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Impossible de créer le répertoire cible pour Lazarus:%s%s%s%s.%sCe répertoire est nécessaire pour le nouvel EDI modifié avec vos paquets personnalisés."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Impossible de supprimer le fichier %s%s%s."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Impossible de supprimer le fichier"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Impossible de supprimer l'ancien fichier d'état %s%s%s%spour le paquet %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Impossible de charger le paquet"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Impossible d'ouvrir le paquet %s%s%s.%sCe paquet a été marqué pour l'installation."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossible de lire l'état du fichier %s%s%s%sdu paquet %s.%sErreur: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Impossible d'écrire le paquet %s%s%s%sdans le fichier %s%s%s.%sErreur: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Impossible d'écrire le fichier d'état %s%s%s%sdu paquet %s.%sErreur: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Désinstaller le paquet ?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Désinstaller le paquet %s? "
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Paquet non enregistré"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Utiliser l'unité"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Avertissement: le fichier %s%s%s%sappartient au présent projet."
#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "Enregistrement d'un paquet"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Ne peut enregistrer des composants sans unité"
#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "Outils de code - des outils et des fonctions pour analyser, passer en revue et éditer des sources Pascal"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Classe de composant %s%s%s déjà définie"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sNom de fichier : %s%s%"
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Classe de composant non valide"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Nom d'unité non valide : %s"
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Fichier paquet non trouvé"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "La procédure Register est à nil"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit a été appellé, mais aucun paquet n'est référencé."
#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Erreur de référencement"
#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - l'éditeur de composants utilisé par Lazarus. http://sourceforge.net/projects/synedit/"
#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "la FCL (FreePascal Component Library) fournit les classes de base pour le Pascal objet."
#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "la LCL (Lazarus Component Library) contient tous les composants de base des fiches."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Le paquet %s%s%s est installé, mais aucun fichier de paquet valide(.lpk) n'a été trouvé.%s Un paquet factice a été créé."
#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "Le RTL - La Run Time Library est la base de tous les programmes Free Pascal. "
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "C'est le paquet par défaut. Utilisez-le seulement pour les composants sans paquet. Ces composants sont obsolètes."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Ce paquet est installé, mais le fichier lpk n'a pas été trouvé. Tous ses composants sont désactivés. Veuillez rectifier ceci."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sNom d'unité : %s%s%"
#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Unité introuvable: %s%s%s"
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "L'unité %s%s%s a été retirée du paquet"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Ce fichier n'est dans aucun des paquets chargés."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Impossible de lire le fichier du paquet %s%s%s.%sErreur: %s"
#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Existe"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Seulement les fichiers existants"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Liens du Paquet"
#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Afficher les liens globaux"
#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Afficher les liens utilisateur"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Utilisateur"
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Veuillez ouvrir une unité avant l'exécution"
#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "S'il vous plaît sélectionnez un mode build en premier"
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Veuillez sélectionner du code pour extraire une nouvelle procédure/méthode."
#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Tout>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Changer la police"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copier le nom de méthode dans le presse-papier"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrer en associant n'importe quelle partie de la méthode"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrer en associant avec le début de la méthode"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Aller à la sélection"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Aucun>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objets"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Liste de procédure"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Type"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Choisissez le répertoire des fichiers .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Ne pas conserver les informations de session"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Pointeur"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Sauver dans le dossier de configuration de l'EDI"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Sauver dans un fichier .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Sauver dans un fichier .lps du dossier projet"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Sauver les informations de session dans"
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Mot précédent"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "Premier répertoire de configuration, là où Lazarrus stocke ses dossiers de configuration. Par défaut c'est"
#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Imprimer"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Méthode privée"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Méthode privée"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Vous devez probablement installer certains paquets avant de pouvoir continuer.%s%sAttention:%sLe projet dépend de certains paquets, qui contiennent des unités avec la procédure Register. La procédure Register est normalement employée pour installer des composants dans l'EDI. Mais les unités suivantes appartiennent aux paquets qui ne sont pas encore installés dans l'EDI. Si vous essayez d'ouvrir une fiche dans l'EDI qui emploie de tels composants, vous obtiendrez des erreurs relatives aux composants absents et le chargement de la fiche créera probablement des résultats très désagréables.%s%sceci n'a aucun impact pour ouvrir le projet ou n'importe lequel de ses sources.%s%sça signifie seulement que : C'est une mauvaise idée d'ouvrir les fiches pour concevoir, avant d'installer les paquets manquants.%s%s"
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procédure"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procédure avec interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programme"
#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Programme%sUn programme FreePascal. Le fichier source du programme est automatiquement géré par Lazarus."
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programme détecté"
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Le fichier source du programme doit avoir une extension Pascal comme .pas, .pp ou .lpr"
#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr "Ajoute des fichiers au projet"
#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Ajouter un fichier au projet:"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Dépendance déjà existante"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Ajouter les fichiers de l'éditeur"
#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Ajouter fichiers"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Version Min-Max non valide"
#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Nom de paquet non valide"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Nom d'unité Pascal invalide"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Version non valide"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Version max. (optionnel)"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Version min. (optionnel) :"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nouvelle condition"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nom du paquet :"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paquet non trouvé"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "La dépendance %s%s%s est introuvable.%sVeuillez choisir un paquet existant."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La version maximale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La version maximale est inférieure à la version minimale."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "La version minimale %s%s%s est non valide.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Le nom de paquet %s%s%s est invalide.%sVeuillez choisir un paquet existant."
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Le projet a déjà une dépendance avec le paquet %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Le nom d'unité %s%s%s existe déjà dans le projet%savec le fichier: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Le nom d'unité %s%s%s existe déjà dans la sélection%savec le fichier: %s%s%s."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Le nom de l'unité %s%s%s n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Ajouter au projet"
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Nom d'unité déjà existant"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projet modifié"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Le projet a changé sur le disque :"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Répertoire du projet"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr ""
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nom de fichier du projet"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Chemin des 'Include' du projet"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Fichier info du projet détecté"
#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Informations sur le projet"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Le projet est exécutable"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Propriétés du projet macro"
#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "macro ProjectUnitPath"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Répertoire de sortie du projet(c'est à dire le répertoire des ppu)"
#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "Chemin du projet:"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Le projet %s à levé une exception de class '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Le projet %s à levé une classe d'exception '%s' avec le message:%s%s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Chemin des sources du projet"
#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Project %s%s%s créer avec succès"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "Unité du projet"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Chemin des unités du projet"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Assistant de projet"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Confirmer la suppression de la dépendance"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Confirmer le retrait du fichier"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Supprimer la dépendance pour %s ?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspecteur de projet - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Paquets requis retirés"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Retirer le fichier %s du projet ?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Impossible de lire l'état du fichier %s du projet %s%sError : %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Impossible d'écrire l'état du fichier pour le projet %s%sError : %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Toujours construit (seulement si rien n'a changé)"
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Erreur"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Impossible de modifier la liste de création automatique des fiches dans le source du programme.%sVeuillez d'abord corriger les erreurs."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Marque de répertoire source du projet"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Demander la valeur"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr ""
#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "Propriétés de l'option de compilation conditionnelle"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Méthode protégée"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Méthode protégée"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Méthode publique"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Méthode publiée"
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Répertoire de publication du projet"
#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Filtre d'exclusion non valide"
#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Filtre d'inclusion non valide"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Sauvegarder les fichiers. LRS dans le répertoire de sortie"
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Éditer l'unité virtuelle"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Il y a déjà une unité avec ce nom.%sFichier: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Le nom d'unité n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Le nom d'unité est employé quand l'EDI prolonge les clauses uses."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Le nom d'unité et de fichier ne doivent pas être identiques. %s Exemple: unit1.pas and Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Convertir un projet Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Nouveau projet"
#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Ouvrir un projet"
#: lazarusidestrconsts.lispwopenrecentproject
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Ouvrir un projet récent"
#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr ""
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr " Solutions rapides"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr ""
#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Quitter Lazarus"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Erreur de lecture"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Enregistrement/Structure"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registres"
#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Nom"
#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Valeur"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Expression régulière"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Chemins relatifs "
#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "Supprimer"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Retirer toutes les propriétés non valides"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Retirer tous les unités"
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr ""
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Retirer du projet"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Supprimer du chemin de recherche"
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Supprimer la variable locale %s"
#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr ""
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr ""
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Retirer les unités sélectionnés"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Les retirer"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""
#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Retirer l'unité de la section uses"
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Renommer le fichier ?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Le changement du nom du fichier a échoué"
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr ""
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Renommer en minuscules"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Réouvrir le projet"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Rouvrir avec un autre encodage"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Nombre de répétitions :"
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr ""
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr ""
#: lazarusidestrconsts.lisreplaceremoveunknown
#, fuzzy
#| msgid "Replace unknown types and properties"
msgid "Fix unknown properties and types"
msgstr "Remplacer les types et les propriétées inconnus"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Echec du remplacement de la sélection"
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/fr"
#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Nécessite FPC 2.4 ou supérieur. Comme les ressources Delphi"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Nouveau balayage"
#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Erreur de lecture de ressource"
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Erreur d'enregistrement de ressource"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr "Type de ressource du projet:"
#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "Réponse:%sContinuer ?"
#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "Résultat :="
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Résultat :"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "Retourne la liste de toutes les valeurs de la variable case en face de la variable"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Echec de la restauration"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Droite"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancrage à droite"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "L'espace de bordure droit. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à droite du contrôle."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "C'est le contrôle à laquelle le côté droit est ancré. Laisser vide pour le parent."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Côtés droits"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Espacement droit égal"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Racine"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Fichier non exécutable"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "L'application hôte %s%s%s n'est pas exécutable."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Exécuter jusqu'à l'échec"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Méthodes abstraites - pas encore surchargées"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Méthodes abstraites de %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Curseur n'est pas dans une déclaration de classe"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "L'EDI est occupé"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s est une classe abstraite, elle a %s méthodes abstraites."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Aucune méthode abstraite trouvée"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Écraser la selection"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Écraser la première selection"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Aucune sélection"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Il y a %s méthodes abstraites à redéfinir. %sSélectionnez les méthodes pour lesquelles des souches doivent être créés :"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Il n'existe pas de méthodes abstraites restantes à redéfinir."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Cette méthode ne peut pas être surchargée car elle est définie dans la classe courante"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Impossible de montrer les méthodes abstraites de la classe courante, parce que"
#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Enregistrer ..."
#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Enregistrer tous les messages dans un fichier"
#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "Enregistrer tous les fichiers modifiés"
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Enregistrer et quitter le dialogue"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Enregistrer et reconstruire l'EDI"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Enregistrer les modifications ?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Enregistrer les modifications du projet %s ?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "Enregistrer le fichier courant"
#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Enregistrer les infos de l'éditeur sauf pour les fichiers projet"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Enregistrer le fichier sous"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Enregistrer le fichier %s%s%s%savant de fermer la fiche %s%s%s ?"
#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Enregistrer les infos de l'éditeur pour les fichiers fermés"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Enregistrer le projet %s (*%s)"
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Enregistrer les paramêtres"
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Enregistrer "
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Facteur d'ajustement:"
#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Rechercher "
#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr " Recherche d'unité"
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "Deuxième répertoire de configuration, là où Lazarus recherche ses fichiers modèles de configuration. Par défaut c'est"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Voir les messages."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sVoir Projet -> Inspecteur de Projet"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Choisir un élément d'aide:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Choisir un noeud"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Sélectionner les fiches Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "sélectionné"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(Voisin du bas sélectionnée)"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(Voisin de gauche sélectionné)"
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(Voisin de droite sélectionné)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(Voisin du haut sélectionné )"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Sélectionner le fichier"
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "La sélection dépasse la taille de constante chaîne"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Sélection d'outils"
#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "sélectionne le mode contruire actif"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Valeur par défaut"
#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr ""
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(paramètre l'indentation par défaut)"
#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "Fixer la valeur"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Court :"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Voir"
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr " Montre les conseils de déclaration"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr ""
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Montre les unités/paquets vides"
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Montre les glyphes pour:"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Afficher la gouttière"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Afficher les conseils dans l'inspecteur d'objet"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Afficher les marques"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Afficher la boîte d'information"
#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Afficher l'ancien ordre de tabulation"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Afficher les paquets"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Afficher les caractères spéciaux"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Afficher la barre d'état"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Afficher les unités"
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Montrez les conseils de valeur pendant de debogage"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Afficher la version et sortir"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Réduction au plus petit"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Contrôle"
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Syntaxe simple"
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Ignorer le fichier"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Passer le fichier et continuer le chargement"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Passer le chargement du dernier projet"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "Petit plutôt que rapide"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Correspondances"
#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Désolé, non implémenté à ce jour"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Désolé, ce type n'est pas encore implémenté"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Croissant"
#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Annuler"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensible à la casse"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Décroissant"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domaine"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorer les espaces"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Lignes"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Options"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragraphes"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Aperçu"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accepter"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Trier la sélection"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Mots"
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "La source et la destination sont identiques:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "Point d'arrêt &source"
#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Le répertoire source %s%s%s%s et le répertoire de destination %s%s%s% sont les mêmes.%s%s Vous avez peut-être mal conpris cette fonctionnalité.%s Elle nettoie/recrée le répertoire de destination%s et y copie le paquet/projet."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Le dossier source %s%s%s n'existe pas."
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Source modifié"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Le source de la page %s%s%s a changé. L'enregistrer ?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Chemins des sources"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Espacement régulier"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "OS source"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Recherche"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Texte à rechercher"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Démarre la conversion"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Démarrer avec un nouveau projet"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Arrêter le débogage courant et reconstruire le projet ?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Arrêt du déboguage ?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Arrêter le débogage ?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Arrêt sur exception"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Arrêt du déboguage ?"
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Fichier .lpi étrange"
#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Erreur de Stream"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Erreur de flux"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Chaîne"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Style"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sous-procédure"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sous-procédure de même niveau"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Succès"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr ""
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr ""
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Révision SVN:"
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nom de variable non valide"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s n'est pas un identificateur valide."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Surcharger une variable système"
#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Mode syntaxe"
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"
#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Odre de tabulation de"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU de destination"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr ""
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr ""
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Fichier de destination du projet"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nom du fichier de destination + paramètres"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "OS de destination"
#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Erreur interne du compilateur ! (%d)"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr ":"
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Répertoire de test"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr ""
#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr ""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "La classe %s%s%s est un TControl et ne peut pas être collée ailleurs que dans un contrôle.%sCollage imposible."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "L'outil de code a décelé une erreur:% s% s% s"
#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "La commande suivant %s%s%s n'est pas exécutable."
#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "La commande après publication est non valide:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Le composant %s ne peut être supprimé, car il n'est pas détenu par %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "L'éditeur de composants de la classe %s%s%s a provoqué l'erreur:%s%s%s%s"
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "L'éditeur de composants de la classe %s%s%s%sappelé avec le verbe #%s %s%s%s%s a provoqué l'erreur:%s%s%s%s"
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Le composant %s est hérité de%s.%sPour supprimer un composant hérité ouvrir l'ancêtre et supprimez-le."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Le composant %s est hérité de%s.%sPour renommer un composant hérité ouvrir l'ancêtre et renommez le là."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr ""
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Le nom de fichier courant du compilateur %s%s%s%sn'est pas un exécutable valide. Choisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Le nom de fichier courant du compilateur %s%s%s%sn'est pas un exécutable valide.%sVeuillez vérifier dans Configuration->Options d'environnement->Fichiers."
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Le répertoire courant des sources Free Pascal %s%s%s%sne semble pas correct.%sChoisissez OK pour revenir à la valeur par défaut%s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers"
#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Le répertoire courant de Free Pascal %s%s%s%sne semble pas correct.%sVérifiez Configuration->Options d'environnement->Fichiers."
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Le répertoire courant de Lazarus %s%s%s%sne semble pas correct.%Sans lui, vous ne pourrez pas créer d'applications LCL.%sChoisissez OK pour revenir à la valeur par défaut %s%s%s.%sSinon, vérifiez Configuration->Options d'environnement->Fichiers."
#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Le répertoire courant de Lazarus %s%s%s%sne semble pas correct.%Sans lui, vous ne pourrez pas créer d'applications LCL.%sVérifiez Configuration->Options d'environnement->Fichiers."
#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Le chemin d'unité courant pour le fichier%s%s%s%s est%s%s%s%s.%s%sLe chemin vers les unités LCL %s%s%s est manquant.%s%sSuggestion pour les nouveaux venus à Lazarus:%sCréez une application Lazarus et placez le fichier dans le dossier du projet."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Le débogueur %s%s%sn'existe pas ou n'est pas exécutable. %s%sVoir Environnement -> Options du Débogueur"
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Le répertoire de destination %s%s%s%s n'existe pas."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Le répertoire de destination %s%s%s n'existe pas.%sVeuillez vérifier le nom de fichier du projet Menu>Projet>Options du projet."
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Le répertoire %s%s%s n'est plus requis dans le chemin d'unité. %sL'enlever ?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "Le répertoire %s%s%s n'est pas accessible en écriture."
#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Le répertoire %s%s%s n'est pas encore dans le chemin d'unité .%sL'ajouter ?"
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Répertoire %s non trouvé"
#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Le fichier %s%s%s"
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Le fichier %s ne resemble pas à un fichier lpi"
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Le fichier %s%s%s est un lien symbolique.%s%sOuvrir %s%s%s à la place ?"
#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Le fichier %s%s%s n'est pas un projet Delphi (.dpr)"
#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Le fichier %s%s%s n'est pas une unité Delphi."
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "Le fichier%s%s%s n'est pas un projet Lazarus.%sCreer un nouveau projet pour ce %s?"
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Le fichier %s%s%s%ssemble être un programme. Fermer le projet en cours et créer un nouveau projet Lazarus pour ce programme?%s'Non' chargera le fichier comme un fichier source normal."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Le fichier %s semble être le fichier programme d'un projet Lazarus existant."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Le fichier %s%s%s%s a été trouvé dans l'un des répertoires source du paquet %s et ressemble à une unité compiler. les unités compilées doive être dans le répertoire de sortie du paquet, sinon d'autres paquets peuvent avoir des difficultés à utiliser ce paquet.%s%s Supprimer le fichier ambigu ?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Le fichier %s%s%s%s n'a pas été trouvé.%sSouhaitez-vous le rechercher manuellement ?%s"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Le fichier %s%s%s%s est introuvable.%sIgnorer continuera à charger le projet;%sAbandonner arrêtera le chargement."
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""
#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr ""
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Les méthodes suivantes employées par %s ne sont pas dans la source %s%s%s%s%s%sEnlever les références pendantes ?"
#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "The compilateur Free Pascal (nom de fichier: %s) est introuvable.%sIl est recommandé que vous installiez FPC."
#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "The répertoire source Free Pascal est introuvable.%sQuelques fonctions de code ne fonctionneront pas.%sIl est recommandé que vous l'installiez et définissiez le chemin%Configuration->Options d'environnement->Fichiers"
#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr ""
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "L'identificateur est une unité. S'il vous plaît utilisez la commande Fichier - Enregistrer afin de renommer une unité."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "La touche %s%s est déjà attribué à %s.%s%s Retirez l'ancienne affectation et affecter la touche à la nouvelle fonction %s%s ?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Le Bundle Application %s%s nécessaire à l'exécution n'existe pas ou n'est pas exécutable.%s Voulez-vous en créer un ? %s%s Voir Project->Options du Project...->Paramètres de l'application."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "L'application à démarrer %s%s%s%sn'existe pas ou n'est pas exécutable.%s%sVoir Exécuter -> Paramètres d'exécution -> Local"
#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Le répertoire de Lazarus est introuvable.%sVous ne pourrez pas créer d'application LCL.%sVeuillez vérifier l'environnement dans Configuration->Options d'environnement->Fichiers"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Le fichier LFM (Lazarus form) contient des propriétés invalides. Cela veut dire qu'il contient des propriétés/classes qui n'existent pas dans la LCL actuelle. L'action recommandée est de retirer ces propriétés du LFM et de corriger le code Pascal manuellement."
#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Le nom %s%s%s n'est pas un identificateur Pascal valide."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "La nouvelle unité n'est pas encore dans le chemin recherche des unités. %s Ajouter le répertoire %s ?"
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Le répertoire de sortie %s%s%s est absent."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche inclusion de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'inclusion hérité de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'unité héritée de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche unité de %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Le répertoire de sortie devrait être un répertoire séparé et ne contenir aucun fichier source."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "La classe propriétaire a ce nom"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Le propriétaire a ce nom"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr ""
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Le paquet contient déjà une unité avec ce nom."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Le paquet %s ne peut pas être désinstallé, car il est nécessaire pour l'IDE lui-même."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Le programme %smake%s est introuvable.%sCet outil est nécessaire pour construire Lazarus.%s"
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr "Le projet n'utilise pas les interfaces de l'unité LCL, mais il semble qu'il en a besoin.%sVous obtiendrez des erreurs étranges avec l'éditeur de liens si vous utilisez les fiches LCL sans interfaces"
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr ""
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Le fichier d'information projet %s%s%s%sest identique au fichier principal du source!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Le fichier d'information du projet %s%s%s%a changé sur le disque."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Le projet doit être enregistré avant d'être construit%sSi vous définissez un répertoire de test dans les options d'environnement,%svous pourrez créer de nouveaux projets et les construire aussitôt.%sEnregistrer le projet ?"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Le projet utilise l'OS cible=%s et le CPU=%s.%sLe fichier system.ppu pour cette cible n'a pas été trouvé dans les répertoires des executables FPC. %sAssurez-vous que FPC est correctement installé pour cette cible et que le fichier fpc.cfg contient les bons répertoires."
#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Le projet utilise les nouvelles ressources de FPC, ce qui nécessite au moins la version 2.4 de FPC"
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "D'autres fichiers dans le répertoire portant le même nom,%sne différent que par la casse:%s%s%sLes effacer ?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Un fichier porte le même nom et une extension similaire%sFichier: %s%sFichier litigieux: %s%s%sEffacer le fichier litigieux ?"
#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr ""
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Il y a déjà un composant avec ce nom"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Il y a déjà une fiche avec le nom %s%s%s"
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr ""
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Une autre unité porte déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Une unité du projet porte déjà le nom %s%s%s.%sVeuillez choisir un nom différent."
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr ""
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "La classe de ressource %s%s%s descend de %s%s%s. C'est probablement une typo pour TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Il y a eu une erreur lors de l'écriture du composant sélectionné %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Il y a eu une erreur lors de la conversion du flux binaire du composant sélectionné %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Il y a eu une erreur lors de la copie du flux du composant vers le presse-papiers:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Le composant racine ne peut être supprimé."
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Ces paramètres sont enregistrés avec le projet."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Ces unités n'ont pas été trouvés:"
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Le répertoire test est introuvable:%s%s%s%s%s(voir les options d'environnement)"
#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "L'unité %s%s%s existe déjà %sIgnorer forcera un changement de nom;%sAnnuler annulera l'enregistrement de ce source et%sArrêter interrompra toute l'opération de sauvegarde."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "L'unité appartient au paquet %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "L'unité %s existe deux fois dans le chemin des unités %s :"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "L'unité a ce nom"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Le nom de l'unité %s%s%s n'est pas en minuscules.%sLe compilateur FreePascal ne recherche pas dans tous les cas. Il est recommandé d'utiliser un nom de fichier en minuscules.%s%s Renommer le fichier en minuscules ?"
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "L'unité %s est utilisé par d'autres fichiers.%sMettre à jour les références automatiquement?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "L'unité a déjà le nom %s%s%s. Les identificateurs Pascal doivent être uniques."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Le chemin de recherche d'unité %s%s%s contient le répertoire des sources %s%s%s du paquet %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Le répertoire de travail %s%s%s n'existe pas.%sVeuillez vérifier le répertoire de travail dans le Menu>Exécuter>Configurer construire."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Cette fonction nécessite une ouverture du fichier. lfm dans l'éditeur de source."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "ce message d'aide"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Ceci ressemble à un fichier Pascal.%sIl est recommandé d'employer des noms de fichier en minuscules, pour éviter divers problèmes sur certains systèmes de fichiers et différents compilateurs.%sRenommer en lettres minuscules?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Le jeux des options pour construire Lazarus n'est pas supporté par cette installation.%sLe répertoire %s%s%s n'est pas inscriptible.%sVoir le site Lazarus pour d'autres façons d'installer Lazarus."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Cette sélection ne peut pas être extraite.%sVeuillez sélectionner du code pour en extraire une nouvelle procédure/méthode."
#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr ""
#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "&Fermer automatiquement en cas de succès"
#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Compilation:"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titre"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Le titre de la barre des tâches montre par exemple: project1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titre (laissez vide pour le défaut)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Fonction : ajouter un délimiteur de chemin"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Fonction : enlever un délimiteur de chemin"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Fonction : extraire l'extension du fichier"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Fonction : extraire le nom et l'extension du fichier"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Fonction : extraire le nom de fichier seul."
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Fonction : extraire le chemin du fichier"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(macro inconnue: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Chemin :"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Commuter affichages les noms de fichiers avec chemins absolus ou relatifs"
#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr ""
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Haut"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancrage en haut"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "L'espace de frontière supérieur. Cette valeur est ajoutée à la base de l'espace de frontière et utilisée pour l'espace au-dessus de la commande."
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Hauts"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "C'est le contrôle à laquelle le côté supérieur est ancré. Laisser vide pour le parent."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Espacement égal en haut"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "L'arborescence a besoin d'un rafraichissement"
#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Ne plus montrer ce message."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Erreur dans l'expression régulière"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Police sans UTF-8"
#: lazarusidestrconsts.lisuegotoline
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Aller à la ligne:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Non trouvé"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Remplacer cette occurence de %s%s%s%s par %s%s%s ?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Recherche de: %s"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Chaîne recherchée '%s' non trouvée !"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "La police courante de l'éditeur ne supporte pas UTF-8, mais votre système semble l'employer. %sCela signifie que des caractères non ASCII seront probablement montrés incorrectement. %sVous pouvez choisir une autre police dans les options de l'éditeur."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Effacer le cache inclure"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s octets"
#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Nettoyer"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Inclus par :"
#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "dans projet:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Lignes :"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nom :"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "non"
#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "OK"
#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Chemins (lecture seule)"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Taille :"
#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Src"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Type:"
#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unité"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "Oui"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Afficher les valeurs des Outils de code"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Impossible de convertir le flux binaire en texte"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Impossible de copier les composants vers le presse-papiers"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossible d'ajouter le commentaire d'en-tête de la ressource au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Impossible d'ajouter la ressource T%s:FORMDATA au fichier ressource %s%s%s%s.%sProbablement une erreur de syntaxe."
#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "Impossible d'ajouter des paramètres"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Impossible d'ajouter %s au projet, car ce dernier contient déjà une unité portant le même nom."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Impossible de faire une copie de sauvegarde du fichier %s%s%s vers %s%s%s!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sImpossible de changer la classe de %s à %s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Impossible de nettoyer le répertoire de destination"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Impossible de nettoyer %s%s%s.Veuillez vérifier les permissions."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Impossible de convertir le composant texte en format binaire:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Impossible de convertir le fichier %s%s%s%sErreur : %s"
#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Impossible de convertir le fichier lfm en lrs et d'écrire le fichier lrs."
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Impossible de convertir les données texte de la fiche du fichier %s%s%s%s%sen flux binaire. (%s)"
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Impossible de copier le fichier"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Impossible de copier le fichier %s%s%s%s vers %s%s%s"
#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Impossible de copier le fichier %s%s%s%svers %s%s%s."
#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Impossible de créer le répertoire de sauvegarde %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Impossible de créer le répertoire %s%s%s."
#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Impossible de créer le répertoire %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Impossible de créer le fichier"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Impossible de créer le fichier %s%s%s"
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Impossible de créer le fichier %s%s%s%s"
#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Impossible de créer le fichier %s%s%s."
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Impossible de créer le lien %s%s%s vers la cible %s%s%s"
#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Impossible de créer une nouvelle méthode. Veuillez corriger l'erreur affichée dans le fenêtre de messages."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Impossible de créer tampon temporaire lfm."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Impossible à supprimer"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Impossible de supprimer le fichier litigieux %s%s%s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Impossible de trouver la section ResourceString dans cette unité ou toute autre utilisée."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "Impossible de trouver un nom de classe valide dans %s%s%s"
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Impossible de trouver le fichier %s%s%s."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "Impossible de trouver le fichier %s%s%s.%sS'il appartient à votre projet, vérifiez le chemin de recherche dans%sProjet->Options du compilateur...->Chemins->Autres fichiers unité. Si ce fichier appartient à un paquet, vérifier les options de compilation appropriées du package. Si ce fichier appartient à Lazarus, assurez-vous que la compilation est propre. Si le fichier appartient à FPC vérifier fpc.cfg. En cas de doute, vérifiez Projet->Options du compilateur...->Test."
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Impossible de trouver %s dans le flux LFM."
#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Impossible de trouver la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "Incapable de trouver l'unité en pascal (.pas,.pp) du fichier .lfm %s%s%s%s"
#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Impossible de trouver l'unité de la classe composante %s%s%s."
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Impossible de recueillir les changements de l'éditeur."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Impossible d'obtenir le source pour le concepteur."
#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr ""
#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Impossible de charger l'ancien fichier ressource.%sLe fichier ressource est le premier fichier inclus dans%sla section initialization.%sPar exemple {$I %s.lrs}.%sProbablement une erreur de syntaxe."
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Impossible de charger le paquet %s%s%s"
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Impossible de charger le composant de classe %s%s%s, parce qu'il dépend de lui-même."
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Impossible d'ouvrir le composant ancêtre"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Impossible d'ouvrir le concepteur .%sLa classe %s ne descend pas d'une classe designable comme TForm ou TDataModule."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Impossible de lire %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Impossible de lire le fichier."
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Impossible de lire le fichier %s%s%s!"
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Impossible de lire le fichier %s%s%s%sErreur: %s"
#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Impossible de lire le fichier %s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossible de lire le fichier d'information du projet %s%s%s%s."
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Impossible de lire le fichier d'information du projet %s%s%s."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Impossible de supprimer l'ancienne copie de sauvegarde %s%s%s!"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Impossible de renommer le fichier litigieux %s%s%s%sen %s%s%s"
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Impossible de renommer le fichier"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Impossible de renommer le fichier %s%s%s en %s%s%s!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Impossible de renommer le fichier %s%s%s%sen %s%s%s."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Impossible de renommer la fiche dans le source."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Impossible de renommer la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Impossible de renommer la variable dans le source."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Impossible d'exécuter"
#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Impossible d'enregistrer le fichier %s%s%s"
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Impossible de placer le Contrôle d'ancrage latéral"
#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Impossible d'afficher la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Impossible de créer un flux pour les composants sélectionnés."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Impossible de créer un flux pour les composants sélectionnés."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Impossible de créer le flux %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Impossible de transformer le flux binaire du composant %s:T%s en texte."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Impossible de mettre à jour la déclaration CreateForm dans le source du projet."
#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Impossible de mettre à jour le fichier de ressources binaires %s%s%s à partir du fichier de ressource texte %s%s%s%s Le fichier texte est probablement corrompu."
#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Impossible d'écrire %s%s%s%s%s."
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Impossible d'écrire %s%s%s"
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Impossible d'écrire le fichier"
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Impossible d'écrire le fichier %s%s%s%sErreur: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Impossible d'écrire le fichier d'information du projet %s%s%s%s.%sError: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""
#: lazarusidestrconsts.lisunabletowritetofile
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Impossible d'écrire dans le fichier %s%s%s."
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Impossible d'écrire le flux xml vers %s%sErreur : %s"
#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "Résultat inattendu:%sLe débogueur va s'arrêter"
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Désinstallation impossible"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Désinstaller la sélection"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "L'unité %s%s%s a été modifiée. L'enregistrer?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "L'identifiateur de l'unité existe"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s unité %s dans le paquet %s%s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nom d'unité déjà existant dans le projet"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Le nom d'unité commence par..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Nom d'unité contient ..."
#: lazarusidestrconsts.lisunitnotfound
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Une unité non trouvée dans"
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Répertoire de sortie de l'unité"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "Chemin des unités"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Chemin des unités"
#: lazarusidestrconsts.lisunitsnotfound2
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Unités non trouvé dans"
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""
#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Unités non utilisées"
#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr "Mise à jour de l'aperçu"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Mise à jour des références ?"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "chaîne en majuscule"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "chaîne de caractère en majuscules donnée en paramètre"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Utiliser message (option -h)"
#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr ""
#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr ""
#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Utiliser le Filtre d'exclusion"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Utilisez l'identificateur"
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Utilise l'identificateur %s dans %s à %s"
#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Utiliser le filtre d'inclusion"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Lancer l'application"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr " Employez le paquet %s dans le paquet %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr " Employez le paquet dans le paquet"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Utilise la paquet %s dans le projet"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Utilise la paquet dans le projet"
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Répertoire Home de l'utilisateur"
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr " Employez l'unité %s dans l'unité %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 avec BOM"
#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr "Valeur :"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Valeur%s"
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valeurs"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Vérifiez les appels de méthodes"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Version"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertical"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copier les informations de version dans le presse-papier"
#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr "Afficher les propriétés du point d'arrêt"
#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Afficher les Unités du Projet"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Afficher le Source (.lfm)"
#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Recherche vers l'avant"
#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Réinitialiser la liste des résultats"
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Avertissement: fichier litigieux trouvé: %s%s%s. Le fichier source est: %s%s%s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""
#: lazarusidestrconsts.liswatch
#, fuzzy
msgid "&Watch"
msgstr "Ajouter un suivi"
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Propriétés des points de suivi"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "Mettre à jour les références si une unité est renommée ..."
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr ""
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""
#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr ""
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Avec les paquets requis "
#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Ajouter"
#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Supprimer"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "&Supprimer tout"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "&Désactiver tout"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "&Activer tout"
#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Activé"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expression"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Propriétés"
#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Liste de suivi"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Mot sous le curseur dans l'éditeur courant"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Répertoire pour construire"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Répertoire pour éxécuter"
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Erreur d'écriture"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Erreur d'écriture : %s%s Fichier : %s%s%s"
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Erreur XML"
#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "Fichiers XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Erreur de l'analyseur XML dans le fichier% s% sErreur :% s"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr ""
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Vous ne pouvez pas construire Lazarus pendant que vous déboguez ou compilez."
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editeur de source"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Ajouter l'unité du paquet à la section Uses"
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Ajouter inverse"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Incrémenter automatiquement le numéro de construction"
#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Scanners disponible"
#: lazarusidestrconsts.rsbuild
#| msgid "Build:"
msgid "&Build:"
msgstr "&Construire:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Jeu de caractères :"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Fermer la page en cours"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Définitions conditionnelles"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Créer une nouvelle définition"
#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "erreur pendant la création du répertoire \"%s\" !"
#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "erreur pendant la création du lien symbolique \"%s\" !"
#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "La création de liens symboliques n'est pas supportée sur cette plateforme!"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Activer i18n"
#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
#| msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "Entrez une ou plusieurs phrases que vous voulez rechercher ou un filtre dans la liste, séparées par un espace, ou une virgule"
#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "Filtrer la liste avec l'expression de filtre actuelle "
#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Fichier de données Fiche (*.dfm)|*.dfm"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Trouvé, mais ne figurent pas ici :"
#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "Aller à l'index suivant dans la liste de recherche"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Options i18n"
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Inclure Version Info dans l'exécutable"
#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Position personnalisée"
#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Valeur par défaut"
#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Attaché"
#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Restaurer la géométrie de la fenêtre"
#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Restaurer la taille de la fenêtre"
#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Utiliser le gestionnaire de fenêtres"
#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Touche"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrique"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabe"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatique (ou anglais)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalan"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinois "
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Tchèque"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Hollandais"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Anglais"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finnois"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Français"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Allemand"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hébreu"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonésien"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italien"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonais"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lithuanian"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Options de langue"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polonais"
#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Portuguais"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russe"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Sélection de la langue:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovaque"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Espagnol"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turque"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrainien "
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Version majeure :"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Version mi&neure"
#: lazarusidestrconsts.rsok
msgid "ok"
msgstr "OK"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Autres informations"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Répertoire de sortie PO"
#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Retirer"
#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "Réinitialiser le filtre"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revision:"
#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Scanners"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Sélectionnez une entrée hérité"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Démarrer une nouvelle recherche"
#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Valeur"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numérotation de version"
#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr "La touche \"%s\" est déjà associée à la commande \"%s\"."
#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Touche alternative (ou combinaison de 2 touches)"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Commandes du menu Aide"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Commandes Défaire/Refaire"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Commandes des outils de code"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Commandes de sélection de la colonne du texte"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Commandes de déplacement du curseur"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Commandes d'édition de texte"
#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Commandes du menu Environnement"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Commandes du menu Fichier"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Commandes pliage de texte"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Commandes des signets"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Commandes du menu Package"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Commandes du menu Projet"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Commandes du menu Exécuter"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Commandes de recherche et remplacement"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Commandes de sélection de texte"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Commandes des onglets de sources"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Edition synchronisée"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Edition synchronisée(pas dans une cellule)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Edition synchronisée(pendant la sélection)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Editer le modèle"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "nexEdition de modèle(pas dans une cellule)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Commandes du menu Outils"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Commandes du menu Voir"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Commande :"
#: lazarusidestrconsts.srkmcommand1
msgid " command1 \""
msgstr " commande 1 \""
#: lazarusidestrconsts.srkmcommand2
msgid " command2 \""
msgstr " commande 2 \""
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflit"
#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " en conflit avec "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Interrompre la construction"
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Ajouter un point de saut"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Ajouter un suivi"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Modèle d'achèvement de code"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copier le bloc"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Effacer le bloc"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Aller au début du bloc"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Aller à la fin du bloc"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Cacher le bloc"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Indenter le bloc"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Déplacer le bloc"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Debut de bloc"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Fin de bloc"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Afficher le bloc"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Basculer le bloc"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Désindenter le bloc"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Construire le programme/projet"
#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "Construire tous les fichiers du programme"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Construire le fichier"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Construire Lazarus"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Caractère"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Supprimer tout le texte"
#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Editeur des directives des outils de code ..."
#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "Options des outils de code"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Sélectionner de colonne en bas"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Sélectiion de colonne à la fin absolue"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Sélection de colonne au début absolu"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Sélection de colonne à gauche"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Sélection de colonne à la fin de la ligne"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Sélection de colonne au début de la ligne"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Sélectionne la colonne du début du texte dans la ligne"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Sélection de colonne au bas de la page"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Sélection de colonne une page plus bas"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Sélection de colonne en haut de la page"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Sélection de colonne une page plus haut"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Sélection de colonne à droite"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Sélection de colonne au dessus"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Sélection de colonne un mot à gauche"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Sélection de colonne un mot à droite"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Mode de sélection en colonne"
#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "Options du compilateur"
#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Compléter le code"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "Fichier de configuration de la construction"
#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Copier la sélection vers le presse-papier"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copie l'éditeur vers une nouvelle fenêtre"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copie l'éditeur vers la fenêtre suivante libre"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copie l'éditeur vers la précédente fenêtre libre"
#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Outil personnalisé %d"
#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Couper la sélection vers le presse-papiers"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Supprimer le début de la ligne"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Supprimer le caractère sous le curseur"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Supprimer la fin de la ligne"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Supprimer le dernier caractère"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Supprimer le début du mot"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Supprimer la ligne courante"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "supprimer la fin du mot"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Différences"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Déplacer le curseur à la toute fin"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Déplacer le curseur au tout début"
#: lazarusidestrconsts.srkmecenvironmentoptions
#| msgid "General environment options"
msgid "IDE options"
msgstr "Options de l'IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "Evaluer/Modifier"
#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Extraire procédure"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Outil externe %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Configurations des outils externes"
#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Chercher le texte"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Chercher la fin d'un bloc"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Chercher le début d'un bloc"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Chercher la déclaration"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Trouver les références de l'identificateur"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "Chercher dans les fichiers"
#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Trouver l'occurence suivante"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Rechercher l'occurrence de mot suivante"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr "Trouver les surcharges"
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Chercher l'occurence précédente"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Rechercher l'occurrence de mot précédente"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Chercher la définition de procédure"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Chercher la méthode"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Plier au curseur"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Pliez au niveau %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Aller à l'éditeur %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Aller à la déclaration d'inclusion du fichier courant"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Aller à la ligne numéro"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Aller au signet %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Aller en XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Deviner les $IFDEF mal placés"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Ajouter une entrée au journal des modifications"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Insérer depuis la table des caractères"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Insérer le mot-clé CVS Author"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Insérer le mot-clé CVS Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Insérer le mot-clé CVS Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Insérer le mot-clé CVS ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Insérer le mot-clé CVS Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Insérer le mot-clé CVS Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Insérer le mot-clé CVS Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Insérer le mot-clé CVS Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Insérer la date et l'heure courantes"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Insérer la notice GPL"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Insérer un GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Insérer la notice LGPL"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Couper la ligne sans bouger le curseur"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Mode insertion"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Insérer la notice modifié LGPL"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Insérer le nom d'utilisateur"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecter"
#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Inverser l'affectation"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Couper la ligne et déplacer le curseur"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Déplacer le curseur en fin de ligne"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Mode sélection de ligne"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Déplacer le curseur en début de ligne"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Déplacer le curseur au début du texte de la ligne"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Vérouille l'éditeur"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Faire une chaîne ressource"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Aller à la parenthèse assortie"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Déplacer l'éditeur vers la gauche"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Déplacer l'editeur tout à gauche"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Déplace l'éditeur vers une nouvelle fenêtre"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Déplacer l'éditeur vers la fenêtre suivante libre"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Déplace l'éditeur vers la première fenêtre libre"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Déplacer l'éditeur vers la droite"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Déplacer l'editeur tout à droite"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Prochain signet"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Aller à l'éditeur suivant"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Aller vers l'éditeur suivant avec la même source"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Aller à la fenêtre suivante"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Mode de sélection normal"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Ouvrir le fichier sous le curseur"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Mode recouvrement"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Déplacer le curseur au bas de la page"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Déplacer le curseur d'une page vers le bas"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Déplacer le curseur d'une page à gauche"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Déplacer le curseur d'une page à droite"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Déplacer le curseur en haut de la page"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Déplacer le curseur d'une page vers le haut"
#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Coller le contenu du presse-papiers à la position courante"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "suspendre le programme"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Signet Précédent"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Aller à l'éditeur précédent"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Aller au précédent éditeur avec la même source"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Aller à la fenêtre précédente"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compiler vite, aucun lien"
#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr "Quitter"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "Enlever le point d'arrêt"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Supprimer les méthodes vides"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr "Enlever les unités non utilisées"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Renommer l'identificateur"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Texte à remplacer"
#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr "Signaler un bogue"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "Réinitialiser le débogueur"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Exécuter le programme"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "Exécuter le fichier"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "Paramètres d'exécution"
#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Enregistrer"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Défilement d'une ligne vers le bas"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Défilement d'un caractère vers la gauche"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Défilement d'un caractère vers la droite"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Défilement d'une ligne vers le haut"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Sélectionner Bas"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Tout sélectionner"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Convertir les tabulations de la sélection en espaces"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Sélectionner jusqu'à la toute fin"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Sélectionner jusqu'au tout début"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Sélectionner Aller en XY"
#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "Sélection gauche"
#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Sélectionner Fin de Ligne"
#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Sélectionner Début de Ligne"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Sélectionner le début du texte dans la ligne"
#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Sélectionner Bas de Page"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Sélectionner Page vers le Bas"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Sélectioner Page vers la Gauche"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Sélectioner page vers la Droite"
#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Sélectionner Haut de Page"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Sélectionner Haut de Page"
#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "Sélection droite"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Sélectionner Haut"
#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Sélectionner Mot de gauche"
#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Sélectionner mot de droite"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Mettre un signet libre"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Définir le marqueur %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Afficher les méthodes abstraites"
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Afficher le contexte de code"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "montrez le point d'exécution"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "Arrêter le programme"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Aller à la dernière position dans la cellule"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Aller à la première position dans la cellule"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Sélectionne la cellule"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Echap"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Cellule suivante"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Cellule suivante(toutes sélectionnées)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Cellule précédente"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cellule précédente(toutes sélectionnées)"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Démarrer l'édition synchronisée"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Aller à la dernière position dans la cellule"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Aller à la première position dans la cellule"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Cellule sélectionnée"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Échap"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Achever"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Cellule suivante"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Cellule suivante(rotation)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Cellule suivante(toutes sélectionnées)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Cellule suivante(rotation / toutes sélectionnées)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Cellule précédente"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cellule précédente(toutes sélectionnées)"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Vérification de la syntaxe"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Voir assembleur"
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr "Basculer point d'arrêt"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Afficher les points d'arrêt"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Afficher la pile d'appel"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Afficher le navigateur de code"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Afficher l'explorateur de code"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Afficher la palette de composant"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Afficher la sortie du débogueur"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Basculer entre Fiche et Unité"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Afficher l'éditeur de documentation"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Afficher les boutons rapides de l'EDI"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Afficher les variables locales"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Définir le signet %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Basculer le surlignage du mot en cours"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Afficher les messages"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Commuter le mode"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Afficher l'Inspecteur d'Pbjets"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Afficher les registres"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Afficher l'explorateur de restrictions"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Afficher les Résultats de Recherche"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Afficher l'Editeur de Source"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Afficher les points de suivi"
#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "Déplier tous"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Déplier au curseur"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "Commande d'édition inconnue"
#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Utilisateur d'abord"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Afficher l'éditeur d'ancres"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Afficher les composants"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Afficher les fiches"
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Afficher les dépendances de l'unité"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Afficher les informations de l'unité"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Afficher les unités"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Compléter le mot"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Déplacer le curseur d'un mot à gauche"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Déplacer le curseur d'un mot à droite"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Éditer les touches de la commande"
#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Editer les touches"
#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Touche d'accroche"
#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Saisir la deuxième touche"
#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Touche (ou combinaison de 2 touches)"
#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Pressez une touche ..."
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr ""
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr ""
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr ""
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Fichier en lecture seule"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Le fichier \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" est protégé en écriture."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Vérouillé"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Ajouter &suivi sous curseur"
#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Aller au signet"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Fermer t&outes les autres pages"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Fermer la page"
#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Compléter le code"
#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Copier"
#: lazarusidestrconsts.uemcopyfilename
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Copier Nom de fichier"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to new Window"
msgstr "Cloner vers une nouvelle fenêtre"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to other Window"
msgstr "Cloner vers une autre fenêtre"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nouvelle fenêtre"
#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Couper"
#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Déboguer"
#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Propriétés de l'éditeur"
#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Entourer la sélection"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Encodage"
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr "&Evaluer/Modifier"
#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Extraire procédure"
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Chercher la déclaration"
#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Trouver la référence de l'identificateur"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Aller au signet"
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Surligneur"
#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr "&Inspecter.."
#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Inverser l'affectation"
#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "Fin de la ligne"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Bloque la Page"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "Déplacer la page à gauche"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "Déplacer la page le plus à gauche"
#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "Déplacer la page à droite"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "Déplacer la page le plus à droite"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "Déplacement vers une nouvelle fenêtre"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr "Déplacement vers une autre fenêtre"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nouvelle Fenêtre"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Aller au signet suivant"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modifié"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "&Ouvrir le fichier sous le curseur"
#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Coller"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Aller au signet précédent"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Aller à la procédure"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Lecture seule"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Retravailler"
#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Renommer l'identificateur"
#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "&Exécuter jusqu'au curseur"
#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Ajouter un signet"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Mettre un signet libre"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Afficher les numéros de ligne"
#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Informations sur l'unité"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "Me&ttre le signet"
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr "&Basculer point d'arrêt"
#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Afficher la pile d'appels"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Non implémenté à ce jour"
#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Je vous l'ai dit : pas encore implémenté"
#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Si VOUS souhaitez aider à implémenter cette fonctionnalité, envoyez un courriel à lazarus@miraclec.com"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "REC"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Lecture seule"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informations sur la version"
|