lazarus-ide-0.9.30.4 0.9.30.4-6 / usr / lib / lazarus / 0.9.30.4 / languages / lazaruside.de.po

msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2011-01-05 16:33+0300\n"
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Language-Team: Deutsch <lazarus@miraclec.com>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Poedit-Language: German\n"
"X-Poedit-SourceCharset: utf-8\n"
"X-Poedit-Country: GERMANY\n"

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Benutzerdefiniertes Schema"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Alle Einstellungen zurücksetzen"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Randleisten-Einstellungen zurücksetzen"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Text-Einstellungen zurücksetzen"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Diese Seite enthält nicht die derzeitigen Einstellungen. Sehen Sie in der erweiterten Seite nach und setzen Sie hier die vorgeschrittenen Änderungen zurück"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Allgemein"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on Mouse down"
msgstr "Standard, Alle Aktionen (Haltepunkte, Faltung) beim Drücken der Maustaste"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on Mouse up. Selection on Mouse down and move"
msgstr "Erweitert, Aktionen (Haltepunkte, Falten) beim Loslassen der Maustaste. Auswahl beim Drücken und Bewegen"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Randleiste"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right mouse includes caret move"
msgstr "Rechte Maustaste bewegt auch den Cursor"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlfmousesimpletextsectalt
msgid "Alt-Key sets column mode"
msgstr "Alt-Taste aktiviert Spaltenmodus"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftlabel
msgid "Ctrl Left Button"
msgstr "Strg + linke Taste"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjump"
msgid "jumps to implementation"
msgstr "zur Implementierung springen"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrjumporblock
msgid "jumps to implementation/other block end"
msgstr "springt zur Implemention/zum anderen Blockende"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectctrlleftrnone"
msgid "nothing"
msgstr "nichts"

#: lazarusidestrconsts.dlfmousesimpletextsectdoubleselline
msgid "Double Click selects line"
msgstr "Doppelklick markiert Zeile"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag Selection (copy/paste)"
msgstr "Auswahl verschieben (kopieren/einfügen)"

#: lazarusidestrconsts.dlfmousesimpletextsectmidgoto
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidgoto"
msgid "jumps to implementation"
msgstr "zur Implementierung springen"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Mittlere Taste"

#: lazarusidestrconsts.dlfmousesimpletextsectmidnone
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectmidnone"
msgid "nothing"
msgstr "nichts"

#: lazarusidestrconsts.dlfmousesimpletextsectmidpaste
msgid "paste selection"
msgstr "Auswahl einfügen"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Änderungen wurden nicht gespeichert. Auf dieser Seite können Änderungen auf der fortgeschrittenen Seite zurückgenommen werden"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Keine >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Schreibgeschützt"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Kleinbuchstaben, erster immer groß"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Zuweisungsoperator := hinzufügen"

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Klammerhervorhebung"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Codefaltungs-Baum"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Standard Text"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Deaktivierter Haltepunkt"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Aktivierter Haltepunkt"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Fehlerzeile"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Ausführungspunkt"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Eingefaltete Code-Markierung"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Allgemein"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Randleiste"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Zeile"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Synchronbearbeitung"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Vorlagenbearbeitung"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
#, fuzzy
msgid "Gutter Separator"
msgstr "Randtrenner"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Inkrementell weitersuchen"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Aktuelles Wort hervorheben"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Inkrementelle Suche"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Ungültiger Haltepunkt"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Aktuelle Zeile hervorgehoben"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Zeilennummer"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Geänderte Zeile"

#: lazarusidestrconsts.dlgaddhiattrmouselink
#, fuzzy
msgid "Mouse link"
msgstr "Maus-Link"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Gewählter Bereich"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Aktive Zelle"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Andere Zellen"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Synchrone Zellen"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Aktive Zelle"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Andere Zellen"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Synchronisierte Zellen"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Textblock"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Unbekannter Haltepunkt"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Wortklammern"

#: lazarusidestrconsts.dlgadditionalsrcpath
msgid "Additional Source search path for all projects (.pp;.pas)"
msgstr "Zusätzlicher Quellcodesuchpfad für alle Projekte (.pp; .pas)"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Strichpunkt hinzufügen"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ausrichten der oberen Zeile vorne am Kommentar"

#: lazarusidestrconsts.dlgallfiles
msgid "All files"
msgstr "Alle Dateien"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alphabetisch"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always visible cursor"
msgstr "Ständig sichtbarer Cursor"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Mehrdeutige Dateiaktion:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Beim Kompilieren warnen"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application Settings"
msgstr "Programmeinstellungen"

#: lazarusidestrconsts.dlgassemblerdefault
msgctxt "lazarusidestrconsts.dlgassemblerdefault"
msgid "Default"
msgstr "Voreinstellung"

#: lazarusidestrconsts.dlgassertcode
msgid "Include Assertion Code"
msgstr "Code für Assertions einfügen"

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Automatisch erzeugte Formulare:"

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "When creating new forms, add them to auto-created forms"
msgstr "Neue Formulare werden beim Erzeugen zu den automatisch generierten zugefügt"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Datei automatisch löschen"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse when typing"
msgstr "Maus beim Tippen verbergen"

#: lazarusidestrconsts.dlgautoindent
msgid "Auto indent"
msgstr "Automat. Einrückung"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Setup smart indent)"
msgstr "(Einrückung festlegen)"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Leere Methoden automatisch entfernen"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Dateinamen in Kleinbuchstaben"

#: lazarusidestrconsts.dlgautosave
msgid "Auto save"
msgstr "Automatisches Speichern"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Verfügbare Formulare:"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Hintergrundfarbe"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(kein Unterverzeichnis)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Gleicher Name (im Unterverzeichnis)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Nach Methoden"

#: lazarusidestrconsts.dlgblockgroupoptions
msgid "Selection:"
msgstr "Auswahl:"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent"
msgstr "Blockeinrückung"

#: lazarusidestrconsts.dlgblockindenttype
msgid "Indent method"
msgstr "Methode einrücken"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Leerz./Tab wie vorherige Zeile"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "nur Position"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Leerzeichen"

#: lazarusidestrconsts.dlgbp7cptb
msgid "TP/BP 7.0 Compatible"
msgstr "TP/BP 7.0-kompatibel"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Klammerhervorhebung"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket pairs"
msgstr ""

#: lazarusidestrconsts.dlgbrowsemsgfilter
msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*"
msgstr "Nachrichtendateien des Free-Pascal-Compilers (*.msg)|*.msg|Alle Dateien (*.*)|*.*"

#: lazarusidestrconsts.dlgbutapply
msgid "Apply"
msgstr "Übernehmen"

#: lazarusidestrconsts.dlgcancel
msgctxt "lazarusidestrconsts.dlgcancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case Sensitive"
msgstr "&Klein-/Großschreibung beachten"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Prüfe Compilereinstellungen"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Ergebnisse"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Überprüfe Compiler ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: Überprüfe Compilerkonfiguration ..."

#: lazarusidestrconsts.dlgccotestcheckingfpcconfigs
msgid "Test: Checking fpc configs ..."
msgstr "Test: Prüfe die FPC-Konfiguration"

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test: Prüfe Compilerdatum ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test: Kompiliere eine leere Datei ..."

#: lazarusidestrconsts.dlgccotestmissingppu
msgid "Test: Checking missing fpc ppu ..."
msgstr "Test: Prüfe fehlende ppu-Dateien von FPC..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: Prüfe die Quellen in den ppu-Suchpfaden von FPC..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: Kompiliere eine leere Datei"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Klassenreihenfolge"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "als letzte"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "Kleinbuchstaben"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (Max line length = 1)"
msgstr "Vorschau (Maximale Zeilenlänge = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Präfix lesen"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Gespeicherte Nachsilbe"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "GROSSBUCHSTABEN"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Variablenpräfix"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Präfix schreiben"

#: lazarusidestrconsts.dlgcentercursorline
msgid "Center Cursor Line"
msgstr "Cursorzeile zentrieren"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename pascal files lower case"
msgstr "Speichern unter (Pascaldateien in Kleinbuchstaben)"

#: lazarusidestrconsts.dlgcheckconsistency
msgid "Check consistency"
msgstr "Konsistenz prüfen"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Packages auf Form-Erzeugung prüfen"

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Auswahl der Code-Vorlagendatei (*.dci)"

#: lazarusidestrconsts.dlgclassinsertpolicy
msgid "Class part insert policy"
msgstr "Richtlinie für das Einfügen von Klassenteilen"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Schließen-Schaltfläche im Notebook anzeigen"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Farbschema"

#: lazarusidestrconsts.dlgcmacro
msgid "C Style Macros (global)"
msgstr "C-artige Makros (global)"

#: lazarusidestrconsts.dlgcoansistr
msgid "Use Ansi Strings"
msgstr "AnsiStrings verwenden"

#: lazarusidestrconsts.dlgcoasis
msgid "As-Is"
msgstr "as-is"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style:"
msgstr "Assembler-Stil:"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Meldungen"

#: lazarusidestrconsts.dlgcochecks
msgid "Checks:"
msgstr "Überprüfungen:"

#: lazarusidestrconsts.dlgcocompilation
msgid "Compilation"
msgstr "Kompilierung"

#: lazarusidestrconsts.dlgcoconditionals
msgid "Conditionals"
msgstr "Bedingungen"

#: lazarusidestrconsts.dlgcocops
msgid "C Style Operators (*=, +=, /= and -=)"
msgstr "C-artige Operatoren (*=, +=, /= und -=)"

#: lazarusidestrconsts.dlgcocreatechildnode
msgid "Create child node"
msgstr "Kindknoten anlegen"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Makedatei anlegen"

#: lazarusidestrconsts.dlgcocreatenodeabove
msgid "Create node above"
msgstr "Knoten unterhalb anlegen"

#: lazarusidestrconsts.dlgcocreatenodebelow
msgid "Create node below"
msgstr "Knoten unterhalb anlegen"

#: lazarusidestrconsts.dlgcodbx
msgid "Generate Debugging Info For DBX (Slows Compiling)"
msgstr "Debugger-Informationen für DBX erzeugen (Verlangsamt das Kompilieren)"

#: lazarusidestrconsts.dlgcodebugging
msgid "Debugging:"
msgstr "Debugger:"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Zusätzlicher Debuggerpfad (keiner):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Quelltexterzeugung"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Beides"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Falten"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Verbergen"

#: lazarusidestrconsts.dlgcodefoldingmouse
msgctxt "lazarusidestrconsts.dlgcodefoldingmouse"
msgid "Mouse"
msgstr "Maus"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr ""

#: lazarusidestrconsts.dlgcodegeneration
msgid "Code generation"
msgstr "Codegenerierung"

#: lazarusidestrconsts.dlgcodetoolsopts
msgid "CodeTools Options"
msgstr "CodeTools-Einstellungen"

#: lazarusidestrconsts.dlgcofast
msgid "Faster Code"
msgstr "Schnellerer Code"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate Debugging Info For GDB (Slows Compiling)"
msgstr "Debugger-Informationen für GDB erzeugen (Verlangsamt das Kompilieren)"

#: lazarusidestrconsts.dlgcogenerate
msgid "Generate:"
msgstr "Erzeuge:"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc Unit"
msgstr "Heaptrc-Unit verwenden"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include Files (-Fi):"
msgstr "Include-Dateien (-Fi):"

#: lazarusidestrconsts.dlgcoinherited
msgctxt "lazarusidestrconsts.dlgcoinherited"
msgid "Inherited"
msgstr "Vererbt"

#: lazarusidestrconsts.dlgcokeepvarsreg
msgid "Keep certain variables in registers"
msgstr "Bestimmte Variablen in Registern halten"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliotheken (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Linken"

#: lazarusidestrconsts.dlgcoloadsave
msgid "Load/Save"
msgstr "Laden/Speichern"

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Farbe"

#: lazarusidestrconsts.dlgcolorexportbutton
msgctxt "lazarusidestrconsts.dlgcolorexportbutton"
msgid "Export"
msgstr "Export"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Farbe ändern)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Nicht modifiziert"

#: lazarusidestrconsts.dlgcommandlineparameters
msgid "Command line parameters"
msgstr "Kommandozeilenparameter"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Kommandozeilenparameter (ohne Programmname)"

#: lazarusidestrconsts.dlgcomovedown
msgid "Move down"
msgstr "Nach unten bewegen"

#: lazarusidestrconsts.dlgcomoveleveldown
msgid "Move level down"
msgstr "Ebene nach unten"

#: lazarusidestrconsts.dlgcomovelevelup
msgid "Move level up"
msgstr "Ebene nach oben"

#: lazarusidestrconsts.dlgcomoveup
msgid "Move up"
msgstr "Nach oben bewegen"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler Messages"
msgstr "Compiler-Meldungen"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file"
msgstr "Compilermeldungen-Sprachdatei"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Compilereinstellungen"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Vollständige Eigenschaften"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config Files:"
msgstr "Konfigurationsdateien:"

#: lazarusidestrconsts.dlgconormal
msgid "Normal Code"
msgstr "Normaler Quelltext"

#: lazarusidestrconsts.dlgcoopts
msgid "Options: "
msgstr "Einstellungen: "

#: lazarusidestrconsts.dlgcoother
msgctxt "lazarusidestrconsts.dlgcoother"
msgid "Other"
msgstr "Andere"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Überlauf"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Parsen"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Kopieren/Einfügen mit Faltungsinformationen"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy word on copy none"
msgstr "Ohne Markierung Wort kopieren"

#: lazarusidestrconsts.dlgcorange
msgid "Range"
msgstr "Bereich"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show Errors"
msgstr "Fehler anzeigen"

#: lazarusidestrconsts.dlgcoshowoptions
#| msgid "Show Options"
msgid "&Show Options"
msgstr "Ein&stellungen anzeigen"

#: lazarusidestrconsts.dlgcosmaller
msgid "Smaller Code"
msgstr "Kompakterer Code"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart Linkable"
msgstr "Smart-Linkbar"

#: lazarusidestrconsts.dlgcosources
msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Andere Quellen (.pp-/.pas-Dateien, nur von der IDE benutzt, nicht vom Compiler)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Stack"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip Symbols From Executable"
msgstr "Debuggersymbole aus der ausführbaren Datei entfernen"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit Style:"
msgstr "Unit-Stil:"

#: lazarusidestrconsts.dlgcouseasdefault
#| msgid "Use these settings as default for new projects"
msgid "Use these compiler options as default for new projects"
msgstr "Diese Einstellungen gelten als Vorgabe für neue Projekte"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Code für valgrind erzeugen"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Ausführlichkeit"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ Styled INLINE"
msgstr "C++-artige Inline-Anweisungen"

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr ""

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor hinter dem Zeilenende"

#: lazarusidestrconsts.dlgcursorgroupoptions
#| msgid "Cursor options:"
msgid "Cursor:"
msgstr "Cursoreinstellungen:"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Cursor skips selection"
msgstr "Cursor überspringt Auswahl"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Cursor skips tabs"
msgstr "Cursor überspringt Tabulatoren"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Benutzerdefinierte Erweiterung (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Pfadeditor"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Debuggertyp und -pfad"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Voreingestellte Schrift im Editor"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Voreinstellung"

#: lazarusidestrconsts.dlgdelphi2ext
msgid "Delphi 2 Extensions"
msgstr "Delphi 2-Erweiterungen"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Vorlage löschen"

#: lazarusidestrconsts.dlgdeplhicomp
msgid "Delphi Compatible"
msgstr "Delphi-kompatibel"

#: lazarusidestrconsts.dlgdesktop
msgid "Desktop"
msgstr "Desktop"

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Buttons -"

#: lazarusidestrconsts.dlgdesktopfiles
msgid "Desktop files"
msgstr "Desktopeinstellungen"

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Hinweise"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menüs - "

#: lazarusidestrconsts.dlgdesktopmisc
msgid "Misc Options"
msgstr "Diverse Optionen"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Richtung"

#: lazarusidestrconsts.dlgdirectorydoesnotexist
msgid "Directory does not exist"
msgstr "Verzeichnis ist nicht vorhanden"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Antialiasing abschalten"

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Verwende Farbe des rechten Randes"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Trennlinie zeichnen"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Geschachtelte Linienfarben"

#: lazarusidestrconsts.dlgdivideronoff
msgid "Draw divider"
msgstr "Trenner zeichnen"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Linienfarbe"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Prozedur/Funktion"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Klasse/Struktur"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Klasse/Struktur (lokal)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Unit-Bereiche"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Uses-Anweisung"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (lokal)"

#: lazarusidestrconsts.dlgdownword
msgctxt "lazarusidestrconsts.dlgdownword"
msgid "Down"
msgstr "Hinunter"

#: lazarusidestrconsts.dlgedadd
msgid "Add..."
msgstr "Hinzufügen..."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Zurück"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Fett"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Unterverzeichnis"

#: lazarusidestrconsts.dlgedcodetempl
msgid "Code templates"
msgstr "Quelltextvorlagen"

#: lazarusidestrconsts.dlgedcolor
#| msgid "Syntax highlight"
msgctxt "lazarusidestrconsts.dlgedcolor"
msgid "Colors"
msgstr "Syntax-Hervorhebung"

#: lazarusidestrconsts.dlgedcompleteblocks
#, fuzzy
#| msgid "Complete blocks"
msgid "Add close statement for pascal blocks"
msgstr "Blöcke vervollständigen"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Benutzerdefinierte Erweiterung"

#: lazarusidestrconsts.dlgeddelay
msgid "Delay"
msgstr "Wartezeit"

#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(%s Sek. Verzögerung)"

#: lazarusidestrconsts.dlgeddelete
msgctxt "lazarusidestrconsts.dlgeddelete"
msgid "Delete"
msgstr "Löschen"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Anzeige"

#: lazarusidestrconsts.dlgededit
msgid "Edit..."
msgstr "Bearbeiten..."

#: lazarusidestrconsts.dlgedfiles
msgid "Editor files"
msgstr "Editordateien"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Bezeichner-Vervollständigung"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Umkehren"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
#, fuzzy
#| msgid "Ignore Locks, longest unused editor"
msgid "Ignore Locks, use longest unused editor"
msgstr "Sperren übergehen, am längsten unbenutzter Editor"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Sperren übergehen,  wenn im aktuellen Editor"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Sperren übergehen, wenn Editor im aktuellen Fenster"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Gesperrt wenn Text sichtbar ist"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Entsperrt"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Entsperrt wenn Text im Zentrum des Ausschnitts"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Neuer Reiter, vorhandenes oder neues Fenster"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Neuer Reiter in neuem Fenster"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Neuer Reiter in vorhandenem Fenster"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
#, fuzzy
#| msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\"This option will always succeed, further options are never tested."
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Diese Option wählt den am längsten freien Editor für die Datei und zwar selbst dann, wenn er gesperrt ist oder wenn gescrollt werden muß. Das bezieht sich auf den Editor und nicht auf das Fenster um den am längsten ungenutzten zu finden. Diese Option hat immer Erfolg, andere werden nicht mehr geprüft."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Diese Option prüft, ob die Zieldatei im derzeit aktiven Editor ist. Falls ja wird dieser genutzt, selbst wenn er gesperrt ist oder wenn er scrollen muß."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Diese Option prüft, ob es im aktuellen Fenster einen Editor für die Zieldatei gibt und falls ja, wird dieser Editor genommen, selbst wenn er gesperrt ist oder wenn gescrollt werden muß."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Diese Option wählt einen gesperrten Editor, der das Sprungziel ohne Scrollen darstellen kann (das Ziel ist bereits im angezeigten Bildschirmbereich)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Diese Option wählt einen beliebigen nicht-gesperrten Editor."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Diese Option wählt einen nicht gesperrten Editor der ohne scrollen den Zielsprungpunkt anzeigen kann (das Ziel befindet sich bereits in der Mitte des sichtbaren Bereichs, nicht in den ersten/letzten 2-5 Zeilen)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Diese Option öffnet einen neuen Reiter in einem vorhandenen oder neuen Fenster falls kein entsperrter Reiter gefunden wurde. Diese Option hat immer Erfolg und es werden keine weiteren Optionen mehr geprüft."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
#, fuzzy
#| msgid "If no unlocked tab is found, then this option will open a new Tab in a new  Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Diese Option öffnet einen neuen Reiter immer in einem neuen Fenster falls kein entsperrter Reiter gefunden wurde. Diese Option hat immer Erfolg und es werden keine weiteren Optionen geprüft."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#, fuzzy
#| msgid "This option will open a new Tab in an existing (and only in an existing) Window, if no unlocked tab is found. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgstr "Diese Option öffnet einen neuen Reiter in einem vorhandenen Fenster, falls kein entsperrter Reiter gefunden wird. Ein Reiter wird nur geöffnet, wenn ein Fenster verfügbar ist, das noch keinen Editor für die Zieldatei enthält."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Kursiv"

#: lazarusidestrconsts.dlgeditorfont
msgid "Editor font"
msgstr "Schriftart"

#: lazarusidestrconsts.dlgeditorfontheight
msgid "Editor font height"
msgstr "Schriftgröße"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Editoreigenschaften"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr ""

#: lazarusidestrconsts.dlgedmisc
msgid "Misc"
msgstr "Verschiedenes"

#: lazarusidestrconsts.dlgednoerr
msgid "No errors in key mapping found."
msgstr "Keine Fehler in der Tastaturbelegung."

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Aus"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "An"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Unterstreichen"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Elementattribute"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Ende-Taste springt zum nächsten Ende"

#: lazarusidestrconsts.dlgentirescope
msgid "&Entire Scope"
msgstr "G&esamter Bereich"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Fragen"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Hinweis: Projektdateien sind alle Dateien im Verzeichnis des Projekts"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Backup"

#: lazarusidestrconsts.dlgenvcolors
msgctxt "lazarusidestrconsts.dlgenvcolors"
msgid "Colors"
msgstr "Farben"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Dateien"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Gitter"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Sprache"

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Hilfslinien"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Verschiedenes"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Keine"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other files"
msgstr "Andere Dateien"

#: lazarusidestrconsts.dlgenvproject
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.dlgeofocusmessagesaftercompilation
msgid "Focus messages after compilation"
msgstr "Fokus nach dem Kompilieren auf die Meldungen setzen"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra char spacing"
msgstr "Zusätzlicher Zeichenabstand"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Zusätzlicher Zeilenabstand"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Externe Datei mit gdb-Debugsymbolen nutzen"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Dateiendungen"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Text am Cursor suchen"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Chunk"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Chunk-Bereich"

#: lazarusidestrconsts.dlgfolddifffile
msgctxt "lazarusidestrconsts.dlgfolddifffile"
msgid "File"
msgstr "Datei"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Kommentar"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Knoten"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Eintrag"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Liste <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objekt (abgeleitet, inline)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (lokal)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Kommentar (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (verschachtelt)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Kommentar { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Klasse/Objekt"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "Public/Private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Geschachtelter Kommentar"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (Prozedur)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Prozedur"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programm"

#: lazarusidestrconsts.dlgfoldpasrecord
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Kommentar //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Unit-Abschnitt"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData-Abschnitt"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Kommentar"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "Dokumenttyp"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Knoten"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Verarbeite Anweisung"

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Vordergrundfarbe"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Prozedur-Einfügerichtlinie"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Reihenfolge der Prozeduren beibehalten"

#: lazarusidestrconsts.dlgfpcpath
msgid "Compiler path (e.g. %s)"
msgstr "Compilerdateiname (%s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC-Quelltextverzeichnis"

#: lazarusidestrconsts.dlgframecolor
#, fuzzy
#| msgid "Frame color"
msgid "Text-mark"
msgstr "Rahmenfarbe"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Formulareditor"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From Cursor"
msgstr "Ab &Cursorposition"

#: lazarusidestrconsts.dlgfropts
msgctxt "lazarusidestrconsts.dlgfropts"
msgid "Options"
msgstr "Einstellungen"

#: lazarusidestrconsts.dlggeneratedwarf
msgid "Generate dwarf debug information"
msgstr "Dwarf-Debug-Informationen erzeugen"

#: lazarusidestrconsts.dlggetposition
msgid "Get position"
msgstr "Stelle ermitteln"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"

#: lazarusidestrconsts.dlggpccomp
msgid "GPC (GNU Pascal Compiler) Compatible"
msgstr "Kompatibel zu GNU Pascal"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Code für gprof erzeugen"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Grabberfarbe"

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Gitterfarbe"

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Gittergröße X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Waagrechte Rasterschrittweite"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Gittergröße Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Senkrechte Rasterschrittweite"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Code-Explorer"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Debugger"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Umgebung"

#: lazarusidestrconsts.dlggrouphelp
msgctxt "lazarusidestrconsts.dlggrouphelp"
msgid "Help"
msgstr "Hilfe"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Gruppenrücknahme"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Hilfslinien anzeigen"

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Randleiste"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Gefaltet"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Farbe der Randleiste"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Trennlinienfarbe"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Trennerindex für Randleiste"

#: lazarusidestrconsts.dlggutterwidth
msgid "Gutter width"
msgstr "Randleistenbreite"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Halbseitiges Scrollen"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap Size"
msgstr "Größe des Heaps"

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Höhe:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "IDE-Fenster beim Start verstecken"

#: lazarusidestrconsts.dlghidemessagesicons
msgid "Hide Messages Icons"
msgstr "Nachrichten-Icons verbergen"

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Reiter bei einseitigen Fenstern ausblenden"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Hervorhebungsfarbe"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Hervorhebungsschriftfarbe"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Cursor"
msgstr "Links vom Cursor"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Cursor"
msgstr "Rechts vom Cursor"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show Hints for parameter \"Sender\" not used"
msgstr "Hintanzeige für unbenutzte Parameter »Sender«"

#: lazarusidestrconsts.dlghintsunused
msgid "Show Hints for unused units in main source"
msgstr "Hinweis a. überflüssige Units im Hauptquelltext"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Pos1-Taste springt zum nächsten Anfang"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Hostapplikation"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier completion"
msgstr "Bezeichner-Vervollständigung"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Bezeichnerrichtlinie"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "IDE Einstellungen"

#: lazarusidestrconsts.dlgignoreverb
msgid "Ignore"
msgstr "Übergehen"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Systemvariablen einfügen"

#: lazarusidestrconsts.dlgindentcodeto
msgid "Indent code to"
msgstr "Code einrücken auf"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
#| msgid "Indents/Tabs options:"
msgid "Indent and Tabs:"
msgstr "Einstellungen für Einrück./Tabs:"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Vor Methoden"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Name des Konstruktors muß »init« sein (Destruktor muß »done« heißen)"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Leerzeichen einfügen nach ..."

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Leerzeichen einfügen vor ..."

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervall in Sekunden"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Springen (bspw. Methodenspringen)"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep cursor X position"
msgstr "X-Position des Cursors beibehalten"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Tastaturbelegung"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Tastenzuweisungsfehler"

#: lazarusidestrconsts.dlgkeymappingscheme
msgid "Key Mapping Scheme"
msgstr "Tastaturbelegungsschema"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Schlüsselwortrichtlinie"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "LABEL und GOTO erlauben"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Sprache"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Letzter (d.h. am Ende des Quelltexts)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus-Verzeichnis (Voreinstellung für alle Projekte)"

#: lazarusidestrconsts.dlgleftpos
msgid "Left:"
msgstr "Links:"

#: lazarusidestrconsts.dlglefttopclr
#, fuzzy
#| msgid "color for left, top"
msgid "Guid lines Left,Top"
msgstr "Farbe für links, oben"

#: lazarusidestrconsts.dlglevel1opt
msgid "Level 1 (quick and debugger friendly)"
msgstr "Stufe 1 (schnell, debuggerfreundlich)"

#: lazarusidestrconsts.dlglevel2opt
msgid "Level 2 (Level 1 + quick optimizations)"
msgstr "Stufe 2 (Stufe 1 + schnelle Opt.)"

#: lazarusidestrconsts.dlglevel3opt
msgid "Level 3 (Level 2 + slow optimizations)"
msgstr "Stufe 3 (Stufe 2 + langsame Opt.)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "Level 0 (no extra Optimizations)"
msgstr "Stufe 0 (keine weiteren Optimierungen)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Zeilentrennung"

#: lazarusidestrconsts.dlglinklibraries
msgid "Link Style:"
msgstr "Linker-Stil:"

#: lazarusidestrconsts.dlglinksmart
msgid "Link Smart"
msgstr "Smart Linken"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display Line Numbers in Run-time Error Backtraces"
msgstr "Zeilennummern in Laufzeitfehler-Backtraces anzeigen"

#: lazarusidestrconsts.dlgloaddfile
msgid "Load desktop settings from file"
msgstr "Einstellungen des Desktops aus Datei laden"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Hauptmenü"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View project forms"
msgstr "Projektfenster anzeigen"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View project frames"
msgstr "Projekt-Frames anzeigen"

#: lazarusidestrconsts.dlgmainviewunits
msgid "View project units"
msgstr "Projektunits anzeigen"

#: lazarusidestrconsts.dlgmakepath
msgid "Make path"
msgstr "Pfad zum Make-Programm"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Rand und Leiste"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Markierungsfarbe"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Word under Caret Highlight"
msgstr "Wort unter Cursor hervorheben"

#: lazarusidestrconsts.dlgmarkupwordfulllen
#, fuzzy
#| msgid "Ignore bounds for words longer than"
msgid "Match word boundaries for words up to this length:"
msgstr "Nur wenn kürzer als"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore Keywords"
msgstr "Schlüsselworte übergehen"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable Timer for Markup Current Word"
msgstr "Timer für Wort-Hervorhebung deaktivieren"

#: lazarusidestrconsts.dlgmarkupwordtrim
#, fuzzy
#| msgid "Trim Spaces"
msgid "Trim Spaces (when highlighting current selection)"
msgstr "Leerzeichen anpassen"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximaler Zähler"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximale Zeilenlänge"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Höchstens gemerkte Dateien"

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Höchstens gemerkte Projektdateien"

#: lazarusidestrconsts.dlgmethodinspolicy
msgid "Method insert policy"
msgstr "Verhalten für das Einfügen von Methoden"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Methoden und Eigenschaften mischen"

#: lazarusidestrconsts.dlgmousefoldbutton
msgctxt "lazarusidestrconsts.dlgmousefoldbutton"
msgid "Button"
msgstr "Schaltfläche"

#: lazarusidestrconsts.dlgmousefoldbuttonleft
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonleft"
msgid "Left"
msgstr "Links"

#: lazarusidestrconsts.dlgmousefoldbuttonmiddle
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonmiddle"
msgid "Middle"
msgstr "Mitte"

#: lazarusidestrconsts.dlgmousefoldbuttonright
msgctxt "lazarusidestrconsts.dlgmousefoldbuttonright"
msgid "Right"
msgstr "Rechts"

#: lazarusidestrconsts.dlgmousefoldcolfoldall
msgid "Fold All (Some Colapsed)"
msgstr "Alle einfalten (einige reduziert)"

#: lazarusidestrconsts.dlgmousefoldcolfoldone
msgid "Fold One (Some Colapsed)"
msgstr "Eine einfalten (einige reduziert)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldall
msgid "Unfold All (Some Colapsed)"
msgstr "Alle ausfalten (einige eingeklappt)"

#: lazarusidestrconsts.dlgmousefoldcolunfoldone
msgid "Unfold One (Some Colapsed)"
msgstr "Einen ausfalten (einige reduziert)"

#: lazarusidestrconsts.dlgmousefoldenabled
msgctxt "lazarusidestrconsts.dlgmousefoldenabled"
msgid "Enabled"
msgstr "Eingeschaltet"

#: lazarusidestrconsts.dlgmousefoldexpfoldall
msgid "Fold All (All Expanded)"
msgstr "Alle einfalten (alle expandiert)"

#: lazarusidestrconsts.dlgmousefoldexpfoldone
msgid "Fold One (All Expanded)"
msgstr "Einen einfalten (alle expandiert)"

#: lazarusidestrconsts.dlgmousefoldgroup1
msgid "Setting 1"
msgstr "Einstellung 1"

#: lazarusidestrconsts.dlgmousefoldgroup2
msgid "Setting 2"
msgstr "Einstellung 2"

#: lazarusidestrconsts.dlgmousefoldmodifieralt
msgctxt "lazarusidestrconsts.dlgmousefoldmodifieralt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmousefoldmodifierctrl
msgctxt "lazarusidestrconsts.dlgmousefoldmodifierctrl"
msgid "Ctrl"
msgstr "Strg"

#: lazarusidestrconsts.dlgmousefoldmodifiershift
msgctxt "lazarusidestrconsts.dlgmousefoldmodifiershift"
msgid "Shift"
msgstr "Umsch"

#: lazarusidestrconsts.dlgmousegroupoptions
#| msgid "Mouse options:"
msgid "Mouse:"
msgstr "Mauseinstellungen:"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgid "Single"
msgstr "Einfach"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgid "Double"
msgstr "Doppelt"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgid "Triple"
msgstr "Dreifach"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgid "Quad"
msgstr "Vierfach"

#: lazarusidestrconsts.dlgmouseoptbtnadd
msgctxt "lazarusidestrconsts.dlgmouseoptbtnadd"
msgid "Add"
msgstr "Hinzufügen"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Jeder"

#: lazarusidestrconsts.dlgmouseoptbtncancel
msgctxt "lazarusidestrconsts.dlgmouseoptbtncancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.dlgmouseoptbtndel
msgctxt "lazarusidestrconsts.dlgmouseoptbtndel"
msgid "Delete"
msgstr "Löschen"

#: lazarusidestrconsts.dlgmouseoptbtndown
msgctxt "lazarusidestrconsts.dlgmouseoptbtndown"
msgid "Down"
msgstr "Hinunter"

#: lazarusidestrconsts.dlgmouseoptbtnexport
msgctxt "lazarusidestrconsts.dlgmouseoptbtnexport"
msgid "Export"
msgstr "Export"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlgmouseoptbtnimport
msgid "Import"
msgstr "Import"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Links"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Mitte"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Fallback anlegen"

#: lazarusidestrconsts.dlgmouseoptbtnok
#| msgid "Ok"
msgctxt "lazarusidestrconsts.dlgmouseoptbtnok"
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Rechts"

#: lazarusidestrconsts.dlgmouseoptbtnudp
msgctxt "lazarusidestrconsts.dlgmouseoptbtnudp"
msgid "Change"
msgstr "Ändern"

#: lazarusidestrconsts.dlgmouseoptbtnup
msgctxt "lazarusidestrconsts.dlgmouseoptbtnup"
msgid "Up"
msgstr "Hoch"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Einfangen"

#: lazarusidestrconsts.dlgmouseoptcaretmove
#, fuzzy
msgid "Move Caret (extra)"
msgstr "Caret bewegen (extra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Beim Loslassen der Maustaste ausführen"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Aktion"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Klick"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Mausbearbeitung"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Doppelter Eintrag"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Eintrag kollidiert mit einem vorhandenen"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Schaltfläche"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgid "Caret"
msgstr "Cursor"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Kontext"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Klick"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Strg"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Aktion"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Hinauf/Hinunter"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Einstellung"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Reihenfolge"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorität"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Umsch"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Maus"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Erweitert"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "IDE-Befehl"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Strg"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "j"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Umsch"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "J"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Randleiste"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Falt-Baum"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Gefaltet [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Entfaltet [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Zeilennummern"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Auswahl"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Andere Aktionen nutzen die selbe Taste"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down..."
msgstr "Sie können abhängig von den Modifizierer-Tasten, Einstellung für das Durchlaufen, Single/Double, Hoch/Runter usw. ausgeführt werden"

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Mod-Tasten filtern"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorität"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Meldungen"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Mehrfachauswahl"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Find editor for jump targets:"
msgstr "Editorauswahl für Sprungziele:"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Reihenfolge für Editoren, für die die selben Kriterien gelten"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Zuletzt fokussierter Editor für die Datei"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (für die Datei) der zuletzt den Fokus hatte"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Kriterieren, nach denen ein Editor ausgewählt wird:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Seiten und Fenster"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs:"
msgstr "Notebook-Reiter:"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Namensvergabe"

#: lazarusidestrconsts.dlgnoautomaticrenaming
#| msgid "no automatic renaming"
msgid "No automatic renaming"
msgstr "Kein automatisches Umbenennen"

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Keine Hervorhebung"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Reiterpositionen des Quell-Notebooks"

#: lazarusidestrconsts.dlgnotebooktabposbottom
msgctxt "lazarusidestrconsts.dlgnotebooktabposbottom"
msgid "Bottom"
msgstr "Unten"

#: lazarusidestrconsts.dlgnotebooktabposleft
msgctxt "lazarusidestrconsts.dlgnotebooktabposleft"
msgid "Left"
msgstr "Links"

#: lazarusidestrconsts.dlgnotebooktabposright
msgctxt "lazarusidestrconsts.dlgnotebooktabposright"
msgid "Right"
msgstr "Rechts"

#: lazarusidestrconsts.dlgnotebooktabpostop
msgctxt "lazarusidestrconsts.dlgnotebooktabpostop"
msgid "Top"
msgstr "Oben"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after:"
msgstr "Zeile nicht teilen nach:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line In front of:"
msgstr "Zeile nicht teilen vor:"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Objektinspektor"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height"
msgstr "Höhe des Eintrags"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Verschiedenes"

#: lazarusidestrconsts.dlgoioptions
msgctxt "lazarusidestrconsts.dlgoioptions"
msgid "Options"
msgstr "Einstellungen"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Schnellumstellung"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Es gelten die Voreinstellungen von Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Es gelten die Voreinstellungen von Lazarus"

#: lazarusidestrconsts.dlgoptimiz
msgid "Optimizations:"
msgstr "Optimierungen:"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other Unit Files (-Fu) (Delimiter is semicolon):"
msgstr "Andere Units (-Fu) (Trenner ist der Strichpunkt):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite Block"
msgstr "Block überschreiben"

#: lazarusidestrconsts.dlgpackagegraph
msgid "Package Graph"
msgstr "Package-Graph"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Hinweise für die Komponentenpalette"

#: lazarusidestrconsts.dlgpasext
msgid "Default pascal extension"
msgstr "Voreingestellte Pascal-Dateiendung"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr ""

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal keyword options"
msgstr "Erweiterte Pascal-Schlüsselwort-Einstellungen"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass Options To The Linker (Delimiter is space)"
msgstr "Linker zusätzliche Einstellungen übergeben (Leerzeichen trennt)"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight String keyword(s)"
msgstr "Hebe String Schlüsselwort(e) hervor"

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Voreinstellung"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Keine"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Nur \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent Block"
msgstr "Persitenter Block"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Persistent cursor"
msgstr "Persistenter Cursor"

#: lazarusidestrconsts.dlgpldpackagegroup
msgid "Package group"
msgstr "Package-Gruppe"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Anwendung"

#: lazarusidestrconsts.dlgpoclearicon
msgid "Clear Icon"
msgstr "Symbol löschen"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Anwendungsbundle erzeugen"

#: lazarusidestrconsts.dlgpodpiaware
msgid "Dpi Aware application (for Vista+)"
msgstr "dpi-abhängige Anwendung (für Vista+)"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formulare"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Symbol:"

#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(Größe: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(keiner)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "Load Icon"
msgstr "Symbol laden"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Verschiedenes"

#: lazarusidestrconsts.dlgpooutputsettings
msgid "Output Settings"
msgstr "Ausgabeeigenschaften"

#: lazarusidestrconsts.dlgposaveicon
msgid "Save Icon"
msgstr "Symbol speichern"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sitzung"

#: lazarusidestrconsts.dlgpotargetfilename
msgid "Target file name:"
msgstr "Zieldateiname:"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titel:"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging (darwin only)"
msgstr "Anwendungs-Bundle für Start und Debug verwenden (nur Darwin)"

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes (windows only)"
msgid "Use manifest file to enable themes (Windows only)"
msgstr "Themen mit Manifest-Datei einschalten (nur in Windows)"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Projekteinstellungen"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Einstellungen für Projekt: %s"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project files"
msgstr "Projektdateien"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt On Replace"
msgstr "&Beim Überschreiben nachfragen "

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Eigenschaftenvervollständigung"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Name der Eigenschaft"

#: lazarusidestrconsts.dlgqautoclosecompiledialog
msgid "Auto close compile dialog"
msgstr "Compilierdialog automatisch schließen"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project at start"
msgstr "Zuletzt geladenes Projekt beim Start öffnen"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Abstand vom Rand"

#: lazarusidestrconsts.dlgqshowcompiledialog
msgid "Show compile dialog"
msgstr "Zeige Compilierdialog"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Gitter anzeigen"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Am Gitter ausrichten"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referenz"

#: lazarusidestrconsts.dlgregularexpressions
msgid "&Regular Expressions"
msgstr "&Reguläre Ausdrücke"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "&Alle ersetzen"

#: lazarusidestrconsts.dlgreplacewith
msgid "&Replace With"
msgstr "E&rsetzen mit"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Report"

#: lazarusidestrconsts.dlgrightbottomclr
#| msgid "color for right, bottom"
msgid "Guide lines Right,Bottom"
msgstr "Farbe für rechts unten"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right Click selects"
msgstr "Rechtsklick wählt aus"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Rechter Rand"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Arbeitsverzeichnis"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Enkel auswählen"

#: lazarusidestrconsts.dlgruberbandcreationcolor
#, fuzzy
#| msgid "Creation"
msgid "Rubberband Creation"
msgstr "Erzeugung"

#: lazarusidestrconsts.dlgruberbandselectioncolor
#, fuzzy
#| msgid "Selection"
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Auswahl"

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Anzeige (nicht bei Win32, beispielsweise 198.112.45.11:0, x.org:1, hydra:0,1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Umgebung"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Lokal"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Systemvariablen"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Display verwenden"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Benutzervorgaben"

#: lazarusidestrconsts.dlgrunovalue
msgctxt "lazarusidestrconsts.dlgrunovalue"
msgid "Value"
msgstr "Wert"

#: lazarusidestrconsts.dlgrunovariable
msgid "Variable"
msgstr "Variable"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run parameters"
msgstr "Start-Parameter"

#: lazarusidestrconsts.dlgsavedfile
msgid "Save desktop settings to file"
msgstr "Desktopeinstellungen in Datei speichern"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Gesicherte Zeile"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Editorinformationen für geschlossene Dateien speichern"

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Editorinformationen nur für Projektdateien speichern"

#: lazarusidestrconsts.dlgscope
msgid "Scope"
msgstr "Bereich"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Eine Zeile weniger scrollen"

#: lazarusidestrconsts.dlgscrollgroupoptions
#| msgid "Scroll options:"
msgid "Scrolling:"
msgstr "Scrolleinstellungen:"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Scroll-Hinweise anzeigen"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Über das Dateiende hinaus scrollen"

#: lazarusidestrconsts.dlgscrollpastendline
#| msgid "Scroll past end of line"
msgid "Caret past end of line"
msgstr "Über das Zeilenende hinaus scrollen"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Suchverzeichnis »%s« nicht gefunden."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Suche vom Benutzer abgebrochen"

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching..."
msgstr "Suche ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Pfade"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected Text"
msgstr "Au&sgewählter Text"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Alle Elemente auf Voreinstellungen setzen"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Element auf die Voreinstellung setzen"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Eigenschaften-Variable setzen"

#: lazarusidestrconsts.dlgshowcaps
msgid "Show component captions"
msgstr "Komponenten-Titel zeigen"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Kompilierte Prozeduren anzeigen"

#: lazarusidestrconsts.dlgshowcompileroptions
msgid "Show compiler options"
msgstr "Compilereinstellungen anzeigen"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Zeilennummern zeigen"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Bedingungen anzeigen"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Debug-Informationen anzeigen"

#: lazarusidestrconsts.dlgshowdefinedmacros
msgid "Show defined macros"
msgstr "Definierte Makros anzeigen"

#: lazarusidestrconsts.dlgshowedrhints
msgid "Show editor hints"
msgstr "Editor-Hinweise anzeigen"

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Alles anzeigen"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Executable-Info anzeigen (nur für Win32)"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Allgemeine Informationen anzeigen"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Leistenhinweise zeigen"

#: lazarusidestrconsts.dlgshowhint
msgid "Show Hints"
msgstr "Hinweise zeigen"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Zeilennummern anzeigen"

#: lazarusidestrconsts.dlgshownotes
msgid "Show Notes"
msgstr "Notizen anzeigen"

#: lazarusidestrconsts.dlgshownothing
msgid "Show nothing (only errors)"
msgstr "Nichts anzeigen (nur Fehler)"

#: lazarusidestrconsts.dlgshowprocserror
msgid "Show all procs on error"
msgstr "Alle Prozeduren bei Fehlern anzeigen"

#: lazarusidestrconsts.dlgshowscrollhint
msgctxt "lazarusidestrconsts.dlgshowscrollhint"
msgid "Show scroll hint"
msgstr "Scroll-Hinweise anzeigen"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Zusammenfassung anzeigen"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Versuchte Dateien anzeigen"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Verwendete Dateien anzeigen"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show Warnings"
msgstr "Warnungen anzeigen"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Einzelnen Schalter im Taskbar anzeigen"

#: lazarusidestrconsts.dlgskipforwarddeclarations
msgid "Skip forward declarations"
msgstr "Vorwärts-Deklarationen überspringen"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Intelligentes Einrücken"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Kennung angehängt (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Zähler (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Kennung vorangestellt (*.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "An Hilfslinien ausrichten"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Leerzeichen"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Hinweise für die Haupt-Speedbuttons (Öffnen, Speichern, ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Quelltexteditor"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Ursprung"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static Keyword in Objects"
msgstr "Schlüsselwort  »Static« in Objekten"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Abbruch nach Fehlerzahl:"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Untereigenschaften"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Syntaxeinstellungen"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tab rückt ganze Blöcke ein"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Reiternummern im Notebook anzeigen"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulatoren in Leerzeichen umwandeln"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Tab-Breite"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Ziel-CPU-Familie"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Ziel-Betriebssystem"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target Platform:"
msgstr "Zielplattform:"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Zielprozessor"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Verzeichnis für das Anlegen von Testprojekten"

#: lazarusidestrconsts.dlgtexttofing
msgid "&Text to Find"
msgstr "Such&text"

#: lazarusidestrconsts.dlgthedirectory
msgid "The directory \""
msgstr "Das Verzeichnis »"

#: lazarusidestrconsts.dlgtimesecondunit
msgid "sec"
msgstr "s"

#: lazarusidestrconsts.dlgtooltipeval
msgid "Tooltip expression evaluation"
msgstr "Tooltip-Ausdrucksauswertung"

#: lazarusidestrconsts.dlgtooltiptools
msgid "Tooltip symbol Tools"
msgstr "Tooltip-Symbol-Werkzeuge"

#: lazarusidestrconsts.dlgtoppos
msgid "Top:"
msgstr "Oben:"

#: lazarusidestrconsts.dlgtplfname
msgid "Template file name"
msgstr "Vorlagendateiname"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim Spaces Style"
msgstr "Leerzeichenbehandlung"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "bei Wechsel oder Bearbeitung"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "bei Zeilenbearbeitung"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "beim Zeilenwechsel"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Nur Position"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Abschneiden von Leerzeichen am Zeilenende"

#: lazarusidestrconsts.dlguncertopt
msgid "Uncertain Optimizations"
msgstr "Unsichere Optimierungen"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Rücknahme auch nach dem Speichern"

#: lazarusidestrconsts.dlgundogroupoptions
#| msgid "Undo options:"
msgid "Undo / Redo:"
msgstr "Einstellungen für Rücknahme"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Rücknahmemaximum"

#: lazarusidestrconsts.dlgunitdepbrowse
msgctxt "lazarusidestrconsts.dlgunitdepbrowse"
msgid "Open"
msgstr "Öffnen"

#: lazarusidestrconsts.dlgunitdepcaption
msgid "Unit dependencies"
msgstr "Unit-Abhängigkeiten"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Erneuern"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Unit-Ausgabeverzeichnis (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Ungesicherte Zeile"

#: lazarusidestrconsts.dlgupword
msgctxt "lazarusidestrconsts.dlgupword"
msgid "Up"
msgstr "Hoch"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code folding"
msgstr "Codefaltung"

#: lazarusidestrconsts.dlgusecustomconfig
#| msgid "Use addional Compiler Config File"
msgid "Use additional Compiler Config File"
msgstr "Zusätzliche Compiler-Konfigurationsdatei einbinden"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider drawing"
msgstr "Trennlinien"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard Compiler Config File (fpc.cfg)"
msgstr "Standard-Compilerkonfigurationsdatei (fpc.cfg) einbinden"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Startprogramm verwenden"

#: lazarusidestrconsts.dlgusemsgfile
msgid "Use messages file"
msgstr "Nachrichtendateien verwenden"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr ""

#: lazarusidestrconsts.dlguseschemedefaults
#, fuzzy
#| msgid "Use global scheme settings"
msgid "Use (and edit) global scheme settings"
msgstr "Globale Schema-Einstellungen verwenden"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Lokale Schema-Einstellungen verwenden"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Nutze Syntaxhervorhebung"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr ""

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Wert"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Compilerausgaben:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Sichtbare Randleiste"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Sichtbarer rechter Rand"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole Words Only"
msgstr "&Nur ganze Wörter"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Breite:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Win32-GUI-Anwendung"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Fenster"

#: lazarusidestrconsts.dlgwinpos
msgid "Window Positions"
msgstr "Fensterpositionen"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Worte"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Vorschau"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write an FPC logo"
msgstr "FPC-Logo ausgeben"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Mehrfachselektion nur auf einem Formular möglich."

#: lazarusidestrconsts.fdmalignword
msgid "Align"
msgstr "Ausrichten"

#: lazarusidestrconsts.fdmdeleteselection
#| msgid "Delete selection"
msgid "Delete Selection"
msgstr "Auswahl löschen"

#: lazarusidestrconsts.fdmmirrorhorizontal
#| msgid "Mirror horizontal"
msgid "Mirror Horizontal"
msgstr "Waagrecht spiegeln"

#: lazarusidestrconsts.fdmmirrorvertical
#, fuzzy
#| msgid "Mirror vertical"
msgid "Mirror Vertical"
msgstr "Senkrecht spiegeln"

#: lazarusidestrconsts.fdmorder
msgctxt "lazarusidestrconsts.fdmorder"
msgid "Order"
msgstr "Reihenfolge"

#: lazarusidestrconsts.fdmorderbackone
#, fuzzy
#| msgid "Back one"
msgid "Back One"
msgstr "Eine Stufe zurück"

#: lazarusidestrconsts.fdmorderforwardone
#, fuzzy
#| msgid "Forward one"
msgid "Forward One"
msgstr "Einen weiter"

#: lazarusidestrconsts.fdmordermovetoback
#, fuzzy
#| msgid "Move to back"
msgid "Move to Back"
msgstr "Nach hinten bewegen"

#: lazarusidestrconsts.fdmordermovetofront
#, fuzzy
#| msgid "Move to front"
msgid "Move to Front"
msgstr "Nach vorn bewegen"

#: lazarusidestrconsts.fdmsaveformasxml
#, fuzzy
#| msgid "Save form as xml"
msgid "Save form as XML"
msgstr "Form im XML-Format speichern"

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Skalieren"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Alles auswählen"

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Größe"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Einstellung: Ans Gitter kleben"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Einstellung: An Hilfslinien ausrichten"

#: lazarusidestrconsts.fdmtaborder
#| msgid "Tab order..."
msgid "Tab Order..."
msgstr "Tabulatorreihenfolge"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-Reihenfolge"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Auf beiden Seiten"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = nein, 1 = Zeichnen einer Trennlinie zwischen zwei Hauptebenen, 2 = Zeichnen von Linien für die ersten beiden Ebenen, ..."

#: lazarusidestrconsts.lisa2paddfile
msgid "Add File"
msgstr "Datei hinzufügen"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Dateien hinzufügen"

#: lazarusidestrconsts.lisa2paddfilestopackage
msgid "Add files to package"
msgstr "Dateien ins Package aufnehmen"

#: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist
msgid "Add LFM, LRS files, if they exist"
msgstr "LFM- und LRS-Dateien hinzufügen, wenn es sie gibt"

#: lazarusidestrconsts.lisa2paddtopackage
msgid "Add to package"
msgstr "Ins Package aufnehmen"

#: lazarusidestrconsts.lisa2paddunit
msgid "Add Unit"
msgstr "Neue Unit"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Mehrdeutige Basisklasse"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Mehrdeutiger Klassenname"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Mehrdeutiger Unit-Name"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor Type"
msgstr "Basisklasse"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Eine Pascal-Unit muß die Endung .pp oder .pas haben"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Abhängigkeiten nicht erfüllt"

#: lazarusidestrconsts.lisa2pchooseanexistingfile
msgid "<choose an existing file>"
msgstr "<vorhandene Datei wählen>"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Klassenname ist bereits belegt"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create new file"
msgstr "Neue Datei anlegen"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Abhängigkeit"

#: lazarusidestrconsts.lisa2pexistingfile
msgid "%sExisting file: %s%s%s"
msgstr "%sVorhandene Datei: %s%s%s"

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Datei ist bereits vorhanden"

#: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject
msgid "File %s%s%s already exists in the project."
msgstr "Datei %s%s%s bereits im Projekt vorhanden."

#: lazarusidestrconsts.lisa2pfilealreadyinpackage
msgid "File already in package"
msgstr "Datei ist bereits im Package"

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Datei ist in Gebrauch"

#: lazarusidestrconsts.lisa2pfilename
msgid "File name:"
msgstr "Dateiname:"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename"
msgstr "Dateiname"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Keine Unit-Datei"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Ungültige Basisklasse"

#: lazarusidestrconsts.lisa2pinvalidcircle
msgid "Invalid Circle"
msgstr "Ungültiger Ringschluß"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Ungültiger Klassenname"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Ungültige Datei"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Ungültiger Dateiname"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Ungültiger Unit-Name"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "%s%s%s is not a valid unit name."
msgstr "%s%s%s ist kein gültiger Unit-Name."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Neuer Klassenname"

#: lazarusidestrconsts.lisa2pnewcomponent
msgid "New Component"
msgstr "Neue Komponente"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Neue Datei"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency %s%s%s.%sPlease choose an existing package."
msgstr "Kein Package für die Abhängigkeit %s%s%s gefunden.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Name des Reiters zu lang"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette Page:"
msgstr "Palettenseite:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal-Unit müssen die Endung .pp oder .pas besitzen"

#: lazarusidestrconsts.lisa2psavefiledialog
msgid "Save file dialog"
msgstr "Datei-speichern-Dialog"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Dateiname verkürzen oder expandieren"

#: lazarusidestrconsts.lisa2pshowall
msgid "Show all"
msgstr "Alles anzeigen"

#: lazarusidestrconsts.lisa2pswitchpaths
msgid "Switch Paths"
msgstr "Pfade tauschen"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Die Basisklasse %s%s%s besitzt den selben Namen wie%sdie Unit %s%s%s."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type %s%s%s is not a valid pascal identifier."
msgstr "Der Basisklassenname %s%s%sist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name %s%s%s and ancestor type %s%s%s are the same."
msgstr "Der Klassenname %s%s%s und der Basisklassenname %s%s%s sind gleich."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s"
msgstr "Der Klassenname %s%s%s ist bereits im%sPackage %s%s enthalten. Datei %s%s%s"

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s."
msgstr "Der Klassename %s%s%s lautet wie der Name der%sder Unit%s%s%s."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name %s%s%s is not a valid pascal identifier."
msgstr "Der Klassenname %s%s%s ist kein gültiger Pascalbezeichner."

#: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage
msgid "The file %s%s%s is already in the package."
msgstr "Die Datei %s%s%s ist bereits im Package."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Die Datei %s%s%s ist Teil des aktuellen Projekts.%sEs ist keine gute Idee, Dateien zwischen Projekten und Packages auszutauschen."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Der Dateiname %s%s%s ist unklar, da für das Package noch kein Verzeichnis voreingestellt istt.%sBitte geben Sie den kompletten Pfad zum Dateinamen mit an.."

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die Maximalversion %s%s%s ist ungültig.%sBitte verwenden Sie das Format major.minor.release.build%s.Z.B.: 1.0.20.10"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Die Maximalversion ist kleiner als die Minimalversion"

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die Minimalversion %s%s%s ist ungültig.%sBitte verwenden Sie das Format major.minor.release.build%sZ.B. 1.0.20.10"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package has already a dependency for the package %s%s%s."
msgstr "Das Package besitzt bereits eine Abhängigkeit auf %s%s%s."

#: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting
msgid "The package name %s%s%s is invalid.%sPlease choose an existing package."
msgstr "Der Package-Name %s%s%s ist ungültig.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name %s%s%s is too long (max 100 chars)."
msgstr "Der Name %s%s%s des Reiters ist zu lang (max. 100 Zeichen)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname %s%s%s already exists in the package:%s%s"
msgstr "Den Unit-Namen %s%s%s gibt es bereits im Package:%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname %s%s%s already exists in this package."
msgstr "Der Unit-Name %s%s%s ist bereits in diesem Package angelegt."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name %s%s%s%sand filename %s%s%s differ."
msgstr "Der Unit-Name %s%s%s%sund der Dateiname %s%s%s unterscheiden sich."

#: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename
msgid "The unit name %s%s%s does not correspond to the filename."
msgstr "Der Unit-Name %s%s%s korrespondiert nicht mit dem Dateinamen."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages."
msgstr "Der Unit-Name %s%s%s ist gleich wie eine registrierte Komponente.%sSeine Verwendung kann zu heftigen Fehlermeldungen führen."

#: lazarusidestrconsts.lisa2punitfilename
msgid "Unit file name:"
msgstr "Unit-Dateiname:"

#: lazarusidestrconsts.lisa2punitfilename2
msgid "Unit File Name:"
msgstr "Unit-Dateiname:"

#: lazarusidestrconsts.lisa2punitname
msgid "Unit Name:"
msgstr "Unit-Name:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Unit-Name ist bereits vorhanden"

#: lazarusidestrconsts.lisa2punitnameinvalid
msgid "Unit Name Invalid"
msgstr "Unit-Name ist ungültig"

#: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure
msgid "Scan Unit for Unit Name and Register procedure"
msgstr "Unit nach Unit-Name und Register-Prozedur durchsuchen"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Änderungen verwerfen?"

#: lazarusidestrconsts.lisabcreationfailed
msgid "Error occured during Application Bundle creation: "
msgstr "Fehler während des Erzeugens des Anwendungspakets: "

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Alles abbrechen"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Alle Ladevorgänge abbrechen"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Das Laden des Projekts abbrechen"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Abbruch beim Laden"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentation:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Über die IDE"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Über Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy
#| msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Lizenz: GPL/LGPL%sLazarus ist eine integrierte Entwicklungsumgebung für das Schreiben grafischer und Konsolenanwendungen mit Free Pascal. Free Pascal ist ein Pascal- und Object-Pascal-Compiler unter (L)GPL für (unter anderem) Windows, Linux, Mac OS X und FreeBSD.%sLazarus ist das fehlende Stück des Puzzles, um Programme für die oben genannten Plattformen in einer Delphi-artigen Umgebung zu entwickeln. Die IDE ist ein RAD-Werkzeug mit einem Formulardesigner.%sMit der Weiterentwicklung von Lazarus brauchen wir zusätzliche Unterstützung."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Kann Liste der Mitwirkenden nicht finden"

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Offiziell:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s can not hold TControls.%sYou can only put non visual components on it."
msgstr "%s darf keine TControls enthalten.%sSie können hier nur nichtvisuelle Komponenten ablegen."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Danksagung"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Aktion:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Aktionen:"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Aktiviere die Syntax regulärer Ausdrücke für Text und Ersetzen (sehr ähnlich zu Perl)"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktiv"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktiver Filter"

#: lazarusidestrconsts.lisadddirectory
msgid "Add directory"
msgstr "Ordner zufügen"

#: lazarusidestrconsts.lisaddfilesofdirectory
msgid "Add files of directory"
msgstr "Dateien des Verzeichnisses zufügen"

#: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages
msgid "Additional compiler options inherited from packages"
msgstr "Von anderen Packages übernommene zusätzliche Compilereinstellungen"

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Fügt neuen Erstellmodus hinzu, Einstellungen kopiert von \"%s\""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Neues Makro hinzufügen"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Neues Set hinzufügen"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Paketabhängigkeit hinzufügen?"

#: lazarusidestrconsts.lisaddpackagetoproject
msgid "Add package %s to project?"
msgstr "Package %s zum Projekt hinzufügen?"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Package zum Projekt hinzufügen"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Parameter-Klammern hinzufügen"

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr ""

#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "%s zum Projekt hinzufügen?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Zum Unit-Suchpfad hinzufügen?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Unit-Interfaces hinzufügen"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Unit hinzufügen (ist nicht angeraten)"

#: lazarusidestrconsts.lisaddvalue
msgid "Add value:"
msgstr "Wert hinzufügen:s"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Wert zum Makro %s hinzufügen"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add file to a package"
msgstr "Datei in Package aufnehmen"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination Package"
msgstr "Ziel-Package"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File Type"
msgstr "Dateityp"

#: lazarusidestrconsts.lisaf2phasregisterprocedure
msgid "Has Register procedure"
msgstr "Besitzt Register-Prozedur"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Ungültiges Package"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: %s%s%s"
msgstr "Ungültige Package-ID: %s%s%s"

#: lazarusidestrconsts.lisaf2pisvirtualunit
msgid "Virtual unit (source is not in package)"
msgstr "Virtuelle Unit (Quellen nicht Teil des Packages)"

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Package ist schreibgeschützt"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package %s%s%s not found."
msgstr "Package %s%s%s nicht gefunden."

#: lazarusidestrconsts.lisaf2pshowall
msgid "Show All"
msgstr "Alle anzeigen"

#: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Die Datei %s%s%s%sbefindet sich bereits im Package %s."

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Das Package %s ist schreibgeschützt."

#: lazarusidestrconsts.lisaf2punitname
msgid "Unit Name: "
msgstr "Unit-Name: "

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file %s%s%s already exists.%sReplace it?"
msgstr "Die Datei %s%s%s ist bereits vorhanden.%sErsetzen?"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Ausrichtung"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks looks ok."
msgstr "Alle Blöcke sehen gut aus."

#: lazarusidestrconsts.lisallfiles
msgid "All Files"
msgstr "Alle Dateien"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Alle übernommenen Einstellungen"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Funktionsaufrufe zulassen"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Suche nach mehrfachen Zeilen erlauben"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to %s%s%s%swill be lost and the file reopened."
msgstr "Die Datei wird neu geöffnet, alle Änderungen an %s%s%s%ssind verloren."

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternativtaste"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternative Taste (oder 2-Tasten-Kombination)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Immer"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Immer ignorieren"

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Mehrdeutige Datei gefunden"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?"
msgstr "Doppelte Datei gefunden: %s%s%s%sDiese Datei kann mit %s%s%s%s%sverwechselt werden. Unklare Datei löschen?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Mehrdeutige Dateien gefunden"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous Unit found"
msgstr "Mehrdeutige Unit gefunden"

#: lazarusidestrconsts.lisambiguousunitfound2
msgid "Ambiguous unit found"
msgstr "Mehrdeutige Unit gefunden"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Ankereditor - kein Kontrollelement ausgewählt"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Eingeschaltet = %s in Anker einfügen"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Anker der ausgewählten Kontrollelemente"

#: lazarusidestrconsts.lisanchortobottomsidekeepborderspace
msgid "Anchor to bottom side of sibling, keep border space"
msgstr "Anker an der Unterrseite des Geschwisters, Randabstand beibehalten"

#: lazarusidestrconsts.lisanchortoleftsidekeepborderspace
msgid "Anchor to left side of sibling, keep border space"
msgstr "Anker an der linken Seite des Geschwisters, Randabstand beibehalten"

#: lazarusidestrconsts.lisanchortorightsidekeepborderspace
msgid "Anchor to right side of sibling, keep border space"
msgstr "Anker an der rechten Seite des Geschwisters, Randabstand beibehalten"

#: lazarusidestrconsts.lisanchortotopsidekeepborderspace
msgid "Anchor to top side of sibling, keep border space"
msgstr "Anker an der Oberseite des Geschwisters, Randabstand beibehalten "

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occured at last startup while loading %s!%s%sLoad this project again?"
msgstr "Ein Fehler trat beim letzten Start während des Ladens von %s auf!%s%sDas Projekt erneut laden?"

#: lazarusidestrconsts.lisappendshortdescriptiontolongdescription
msgid "Append short description to long description"
msgstr "Kurze Beschreibung zur langen Beschreibung hinzufügen"

#: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra
#, fuzzy
#| msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus."
msgid "Application%sA graphical LCL/Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Applikation%sEin grafisches LCL/Free-Pascal-Programm. Die Programmdatei wird automatisch von Lazarus gepflegt."

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Anwendungsklassenname"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Build-Flag (-B) auf für die Abhängigkeiten setzen"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr ""

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Eine Projekt-Unit kann nicht von anderen Packages/Projekten verwendet werden"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Randabstand um das Kontrollelement. Die anderen vier Randabstände werden zu diesem Wert addiert."

#: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi
msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project."
msgstr "Eine einfache Pascal-Programmdatei.%sSie dient dem schnellen Testen.%sBesser ist es, ein neues Projekt anzulegen."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Vor dem  Ersetzen immer nachfragen"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form"
msgstr "Nach dem Ablegen auf einem Designer-Fenster nach dem Komponentennamen fragen"

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Nach Dateinamen für neue Datei fragen"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Komponentennamen beim Neuanlegen abfragen"

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Auto-Vervollständigung: aus"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Auto-Vervollständigung: an"

#: lazarusidestrconsts.lisautocontinue
msgid "Auto Continue"
msgstr "Automatisches Fortsetzen"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Automatisch fortsetzen nach:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr ""

#: lazarusidestrconsts.lisautomatic
msgid "Automatic"
msgstr "Automatisch"

#: lazarusidestrconsts.lisautomaticallyconvertlfmfilestolrsincludefiles
msgid "Automatically convert .lfm files to .lrs include files"
msgstr ".lfm-Dateien automatisch in .lrs-Include-Dateien umwandeln"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Automatisch nach Punkt aufrufen"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "Zeilenumbruch"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "Leerzeichen"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "Wordende"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "Zeichen nicht hinzufügen"

#: lazarusidestrconsts.lisautomaticfeatures
#, fuzzy
#| msgid "Automatic features"
msgid "Completion and Hints"
msgstr "Automatische Funktionen"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Objektinspektor automatisch anzeigen"

#: lazarusidestrconsts.lisavailablepackages
msgid "Available packages"
msgstr "Verfügbare Packages"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Sicherung der geänderten Dateien anlegen"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Dateisicherung fehlgeschlagen"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Erzeugt ein Backup-Verzeichnis unterhalb des Projektverzeichnisses"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Das Ändern des Package-Namens oder der Version zerstört Abhängigkeiten. Sollen diese Abhängigkeiten ebenfalls geändert werden?%sWählen Sie »Ja«, um alle aufgeführten Abhängigkeiten zu ändern.%sWählen Sie »Übergehen«, um die Abhängigkeiten zu löschen und fortzufahren."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "beginnt"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "nach ähnlichen"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always Build before Run"
msgstr "Vor dem Start immer neu kompilieren"

#: lazarusidestrconsts.lisbfbuild
msgctxt "lazarusidestrconsts.lisbfbuild"
msgid "Build"
msgstr "Neu kompilieren"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Befehl für Neukompilieren"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Beim Neukompilieren des Projekts »Datei kompilieren« aufrufen"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Beim Start des Projekts statt dessen »Datei ausführen« aufrufen"

#: lazarusidestrconsts.lisbfrun
msgctxt "lazarusidestrconsts.lisbfrun"
msgid "Run"
msgstr "Start"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Befehl ausführen"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor ..."
msgstr "Wenn diese Datei im Quelltexteditor aktiv ist ..."

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (Leave empty for file path)"
msgstr "Arbeitsverzeichnis (keine Angabe heißt Dateipfad)"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2
msgid "Working Directory (Leave empty for file path)"
msgstr "Arbeitsverzeichnis (keine Angabe heißt Dateipfad)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Nicht voreingestellte Werte fett hervorheben"

#: lazarusidestrconsts.lisborderspace
msgid "BorderSpace"
msgstr "Randbreite"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Unten"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Unterer Randabstand, Der Wert wird zum Basis-Randabstand addiert und für den Platz unter dem Element verwendet."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Untere Verankerung"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Untere Kanten"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol, an das die Unterseite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Gleichmäßig am unteren Rand aufteilen"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Halt"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Haltepunkt-Eigenschaften"

#: lazarusidestrconsts.lisbrowseforcompiler
msgid "Browse for Compiler (%s)"
msgstr "Nach dem Compiler (%s) suchen"

#: lazarusidestrconsts.lisbtnbreak
msgctxt "lazarusidestrconsts.lisbtnbreak"
msgid "Break"
msgstr "Halt"

#: lazarusidestrconsts.lisbtncontinue
msgctxt "lazarusidestrconsts.lisbtncontinue"
msgid "Continue"
msgstr "Fortsetzen"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "Suchen"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "E&rsetzen"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "alle Dateien des Projekts/Packages/IDE kompilieren"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "IDE mit allen Packages kompilieren"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Neukompilieren von Lazarus fehlgeschlagen"

#: lazarusidestrconsts.lisbuildmacros
msgid "Build macros"
msgstr "Erstellmakros"

#: lazarusidestrconsts.lisbuildmacros2
msgid "Build macros:"
msgstr "Erstellmakros:"

#: lazarusidestrconsts.lisbuildmode
msgid "Build mode"
msgstr "Modus für Neukompilieren"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Unterschiede zwischen den Erstellmodi"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences to other build modes"
msgstr "Unterschiede zu anderen Erstellmodi"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modus:"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Erstellmodi"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Neues Projekt kompilieren"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build Number"
msgstr "Nummer des Builds"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Der Aufruf von %s um die Makedatei von %s anzulegen schlug fehl."

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Laden dieser Komponente abbrechen"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Laden der Unit abbrechen"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Umbenennen abbrechen"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Kann Projekt nicht kompilieren"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Can not copy top level component."
msgstr "Kann die obere Komponente nicht kopieren"

#: lazarusidestrconsts.liscannotcreatefile
msgid "Can not create file %s%s%s"
msgstr "Kann die Datei %s%s%s nicht anlegen"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find lazarus starter:%s%s"
msgstr "Kann Lazarus-Starter %s%s nicht finden"

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Kann nur die Klasse von TComponents ändern."

#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Klasse von %s ändern"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "keine Klasse"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Unklarer Compiler"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects"
msgstr "Bitte prüfen Sie das Test-Verzeichnis unter %sEinstellungen -> Umgebungseinstellungen -> Dateien -> Verzeichnis für das Anlegen von Testprojekten"

#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Der Compiler »%s« ist keine ausführbare Datei.%sDetails: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "enthält "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Ausgabe in die Zwischenablage kopieren"

#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Die Daten der .ppu-Dateien von FPC unterscheiden sich um mehr als eine Stunde.%sDas kann bedeuten, daß sie von zwei verschiedenen Installations stammen.%sDatei1: %s%sDatei2: %s"

#: lazarusidestrconsts.lisccoenglishmessagefilemissing
msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg"
msgstr "Datei mit den deutschen Meldungen für FPC fehlt:components/codetools/fpc.errord.msg"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Fehler"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "FEHLER: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "FPC-Unitpfad enthält eine Quelle: "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "Zeilenumbruchzeichen"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "ANMERKUNG: "

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Ungültiger Compiler"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Ungültiger Suchpfad"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Ungültiges Testverzeichnis"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Fehlende Unit"

#: lazarusidestrconsts.lisccomsgppunotfound
msgid "compiled FPC unit not found: %s.ppu"
msgstr "kompilierte FPC-Unit nicht gefunden: %s.ppu"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "Mehrere Compilerkonfigurationen gefunden: "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "keine fpc.cfg gefunden"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "Nicht-ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu ist zweimal vorhanden: %s, %s"

#: lazarusidestrconsts.lisccoppunotfounddetailed
msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken."
msgstr "Die kompilierte FPC-Unit %s wurde nicht gefunden.%sDas bedeutet normalerweise, daß die fpc.cfg einen Fehler enthält oder die FPC-Installation defekt ist"

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Es gibt eine .ppu Datei, die älter als der Compiler ist:%s%s"

#: lazarusidestrconsts.lisccorelunitpathfoundincfg
msgid "relative unit path found in fpc cfg: %s"
msgstr "relativer Unitpfad in der fpc.cfg: %s"

#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Es sind mehrere Free-Pascal-Compiler im Pfad.%s%s%sWurde vergessen, einen alten Compiler zu löschen?"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Übergehen"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "Sonderzeichen"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Alle Tests erfolgreich verlaufen."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Kann Testdatei nicht erzeugen"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test pascal file \"%s\"."
msgstr "Kann Test-Pascal-Datei »%s« nicht schreiben."

#: lazarusidestrconsts.lisccounabletogetfiledate
msgid "Unable to get file date of %s."
msgstr "Kann Dateidatum von %s nicht lesen."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "ungewöhnliche Zeichen"

#: lazarusidestrconsts.lisccowarningcaption
msgid "Warning"
msgstr "Warnung"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "WARNUNG: "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "Falscher Pfadtrenner"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Kategorien"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Komplexität"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konstanten"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Leere Blöcke"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Leere Klassensektionen"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Leere Konstrukte"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Leere Prozeduren"

#: lazarusidestrconsts.liscefilter
msgid "(Filter)"
msgstr "(Filter)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Cursor folgen"

#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s in %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Ist ein Wurzelelement"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treating as \"many\""
msgstr "Parameterzahl als »viele« behandeln"

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Lange Prozeduren"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Zeilenzählung der Prozedur als »lang« behandeln"

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Viele geschachtelte Prozeduren"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Viele Parameter"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Kategorien anzeigen"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Quellknoten anzeigen"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treating as \"many\""
msgstr "Zählung der geschachtelten Prozeduren als »viele« behandeln"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling"
msgstr "Kontrollelement waagrecht relativ zum angegebenen Geschwister zentrieren"

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling"
msgstr "Kontrollelement senkrecht relativ zum angegebenen Geschwister zentrieren"

#: lazarusidestrconsts.liscenterform
msgid "Center form"
msgstr "Form zentrieren"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Im Fenster zentrieren"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Zentriert"

#: lazarusidestrconsts.lisceomode
msgid "Preferred Exhibition Mode"
msgstr "Gewünschter Darstellungsmodus"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Kategorie"

#: lazarusidestrconsts.lisceomodesource
msgid "Source"
msgstr "Quelle"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Niemals automatisch"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Nur im Kategorien-Modus verwendet"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Im Leerlauf"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automatische Aktualisierung"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Andere"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Aktualisierung"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Beim Umschalten von Dateien im Quelltexteditor"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Prozeduren"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Properties"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Published-Eigensch. ohne Voreinstell."

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observerations about"
msgstr "Zeige Überwachungen von"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Stil"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Zu Erledigendes"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Datentypen"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Unbenannte Konstanten"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Nicht sortierte Mitglieder"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Nicht sortierte Sichtbarkeit"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variablen"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Falsche Einrückung"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr ""

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Klasse ändern"

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Kodierung ändern"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Datei ändern"

#: lazarusidestrconsts.lischangeparent
#| msgid "Change parent ..."
msgid "Change Parent..."
msgstr "Elternobjekt ändern ..."

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Zeichen"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Zeichentabelle"

#: lazarusidestrconsts.lischeckchangesondiskwithloading
msgid "Check changes on disk with loading"
msgstr "Änderungen auf dem Datenträger beim Laden prüfen"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgstr "prüfen, ob der nächste Token im Quelltext ein End ist und falls nicht, Zeilenende + End; + Zeilende zurückgeben"

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Einstellungen prüfen"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Anderen Dateinamen auswählen"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "FPDoc-Link wählen"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Taste auswählen..."

#: lazarusidestrconsts.lischooseanameforthenewcomponent
msgid "Choose a name for the new component"
msgstr "Geben Sie den Namen der neuen Komponente an"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a pascal file for indentation examples"
msgstr "Geben Sie eine Pascal-Datei für die Einrückungsbeispiele an"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Compiler Meldungen Datei auswählen"

#: lazarusidestrconsts.lischoosecompilerpath
msgid "Choose compiler filename (%s)"
msgstr "Auswahl des Compilerdateinamens (%s)"

#: lazarusidestrconsts.lischoosedebuggerpath
msgid "Choose debugger filename"
msgstr "Auswahl des Debuggerdateinamens"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Delphi-Package (*.dpk) auswählen"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Delphi-Projekt (*.dpr) auswählen"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Delphi-Unit (*.pas) auswählen"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Verzeichnis auswählen"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "FPC Quelltextverzeichnis auswählen"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Lazarus-Verzeichnis auswählen"

#: lazarusidestrconsts.lischoosemakepath
msgid "Choose make path"
msgstr "Make-Dateinamen auswählen"

#: lazarusidestrconsts.lischoosename
msgid "Choose name"
msgstr "Name auswählen"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Wählen Sie einen dieser Punkte, um eine neue Datei anzulegen"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Wählen Sie einen der Einträge, um ein neues Package zu erzeugen"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Wählen Sie einen der Einträge, um ein neues Projekt zu generieren"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Wählen Sie einen der Einträge aus, um von einem vorhandenen abzuleiten"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Programmquelltext (*.pp, *.pas, *.lpr) auswählen"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Wählen Sie die Struktur um die Auswahl einzuschließen"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Verzeichnis für Tests auswählen"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Klassenvervollständigung"

#: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic
#, fuzzy
msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit."
msgstr "Die Klasse steht in Konflikt mit der .lfm-Datei:%sDie Unit %s%snutzt die Unit %s%sdie die Klasse %s enthält%saber die .lfm-Datei enthält bereits eine andere Klasse.%sEine Unit darf aber nur eine Design-Klasse enthalten.%sBitte verschieben Sie %s in eine andere Unit."

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Klassen und Eigenschaften existieren. Werte wurden nicht geprüft."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class %s%s%s is not a registered component class.%sUnable to paste."
msgstr "Klasse %s%s%s ist keine registrierte Komponentenklasse.%sKann keine Übernahme durchführen."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Klasse nicht gefunden"

#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class %s%s%s of method %s%s%s not found."
msgstr "Klasse %s%s%s der Methode %s%s%s nicht gefunden."

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Verzeichnis säubern"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Unterverzeichnisse säubern"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Alle Textdateien behalten"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Dateien, die mit dem Filter übereinstimmen, behalten"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Entfernen der Dateien, auf die der Filter paßt"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Einfache Syntax (z.B. * statt .*)"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Lazarus-Quelltext aufräumen"

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Unit-Pfad aufräumen?"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Verzeichnis leeren?"

#: lazarusidestrconsts.lisclearkeymapping
msgid "Clear Key Mapping"
msgstr "Tastaturbel. löschen"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Hier klicken um die Datei zu browsen"

#: lazarusidestrconsts.lisclicktoseethepossibleuses
msgid "Click to see the possible uses"
msgstr ""

#: lazarusidestrconsts.lisclose
msgid "&Close"
msgstr "S&chließen"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Dateien schließen"

#: lazarusidestrconsts.lisclosealltabshide
msgid "Hide window"
msgstr "Verstecke Fenster"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Ein Quelltextfenster wird geschlossen. Sollen alle Dateien geschlossen oder das Fenster versteckt werden?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Schließen des Quelltexteditors"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Schnittstellenspezische Einstellungen der LCL:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parameter"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponenten"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Vererbung"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Liste"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Palette"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Mehrdeutige zusätzliche Compiler-Konfigurationsdatei"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Aufruf an:"

#: lazarusidestrconsts.liscocallonbuild
msgctxt "lazarusidestrconsts.liscocallonbuild"
msgid "Build"
msgstr "Neukompilieren"

#: lazarusidestrconsts.liscocalloncompile
msgctxt "lazarusidestrconsts.liscocalloncompile"
msgid "Compile"
msgstr "Kompilieren"

#: lazarusidestrconsts.liscocallonrun
msgctxt "lazarusidestrconsts.liscocallonrun"
msgid "Run"
msgstr "Start"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you are sure to do that."
msgstr "%s%sKlicken Sie OK, wenn Sie sicher sind."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Befehl:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr ""

#: lazarusidestrconsts.liscodebrowser
msgid "Code browser"
msgstr "Code-Browser"

#: lazarusidestrconsts.liscodeexplorer
msgctxt "lazarusidestrconsts.liscodeexplorer"
msgid "Code Explorer"
msgstr "Code-Explorer"

#: lazarusidestrconsts.liscodefault
msgid "default (%s)"
msgstr "Voreinstellung (%s)"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Einstellungen für Codeerzeugung"

#: lazarusidestrconsts.liscodehelpaddlinkbutton
msgid "Add link"
msgstr "Neuer Link"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Neuer Pfad"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Pfadauswahl"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Ersetzen bestätigen"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Hilfepunkt erzeugen"

#: lazarusidestrconsts.liscodehelpdeletelinkbutton
msgid "Delete link"
msgstr "Lösche Verknüpfung"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Pfad entfernen"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Beschreibung"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Fehler"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Beispiel"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Formatzeichen für Fettschrift einfügen"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Formatzeichen für Code einfügen"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Formatzeichen für Kursivschrift einfügen"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Formatzeichen für Kommentar einfügen"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Formatzeichen für Unterstreichung einfügen"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Formatzeichen für Var einfügen"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Vererbt"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Einen Link einfügen ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Absatzformat-Tag einfügen"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgid "FPDoc editor"
msgstr "FPDoc-Editor"

#: lazarusidestrconsts.liscodehelpnodocumentation
msgctxt "lazarusidestrconsts.liscodehelpnodocumentation"
msgid "(none)"
msgstr "(keiner)"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(keine abgeleitete Beschreibung gefunden)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<KEINE>"

#: lazarusidestrconsts.liscodehelppathsgroupbox
msgctxt "lazarusidestrconsts.liscodehelppathsgroupbox"
msgid "FPDoc files path"
msgstr "FPDoc-Dateipfad"

#: lazarusidestrconsts.liscodehelpreplacebutton
msgctxt "lazarusidestrconsts.liscodehelpreplacebutton"
msgid "Replace"
msgstr "Ersetzen"

#: lazarusidestrconsts.liscodehelpsavebutton
msgctxt "lazarusidestrconsts.liscodehelpsavebutton"
msgid "Save"
msgstr "Speichern"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Siehe auch"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Kurzbeschreibung von"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Kurz"

#: lazarusidestrconsts.liscodehelpshowemptymethods
msgid "Show empty methods"
msgstr "Leere Methoden anzeigen"

#: lazarusidestrconsts.liscodehelpshowunusedunits
msgid "Show unused units"
msgstr "Unbenutzte Units anzeigen"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Übergehe Konstanten in den nächsten Funktionen"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Suche nach unbenannten Zeichenkonstanten"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Codeüberwachung (Code Observer)"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Nächste unbenannte Konstanten übergehen"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add"
msgstr "Hinzufügen"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Codevorlage hinzufügen"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token %s%s%s already exists! "
msgstr " Es gibt bereits ein Token %s%s%s!"

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on ..."
msgstr "Automatisches Vervollständigen an ..."

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Ändern"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Kommentar:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Code-Vorlage bearbeiten"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Fehler"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Token:"

#: lazarusidestrconsts.liscodetools
msgid "CodeTools"
msgstr "CodeTools"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Aktion: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes."
msgstr "Automatisch erzeugte Einträge können weder bearbeitet werden,%s noch können sie manuelle Untereinträge haben."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, automatisch erzeugt"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes can not be edited."
msgstr "Automatisch angelegte Einträge können nicht bearbeitet werden."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Block"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Vorschau für CodeTools-Einstellungen"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview
msgid "CodeTools Defines Preview"
msgstr "Vorschau für CodeTools-Einstellungen"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "compiler path"
msgstr "Compilerpfad"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Wandle Knoten um"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Defines für das Verzeichnis %s anlegen"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Definitionen für den Free Pascal Compiler anlegen"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Definitionen für Free-Pascal-SVN-Quelltexte anlegen"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir
msgid "Create Defines for Lazarus Directory"
msgstr "Definitionen für Free-Pascal-Verzeichnis anlegen"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Defines für das Projekt %s anlegen"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "FPC-Makros und Pfaden für ein FPC-Projektverzeichnis anlegen"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definition"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Rekursion festlegen"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Knoten löschen"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%s.Beispielsweise C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem Projekt verwendet werden%sBeispielsweise C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Beschreibung:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "%s Verzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsedit
msgctxt "lazarusidestrconsts.liscodetoolsdefsedit"
msgid "Edit"
msgstr "Bearbeiten"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefserrorreading
msgid "Error reading %s%s%s%s%s"
msgstr "Fehler beim Lesen von %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile
msgid "Error reading project info file %s%s%s%s%s"
msgstr "Fehler beim Lesen der Projektinfo-Datei %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting
msgid "Error while writing %s%s%s%s%s"
msgstr "Fehler beim Schreiben %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile
msgid "Error while writing project info file %s%s%s%s%s"
msgstr "Fehler beim Schreiben der Projekteinstellungsdatei %s%s%s%s%s"

#: lazarusidestrconsts.liscodetoolsdefsexit
msgctxt "lazarusidestrconsts.liscodetoolsdefsexit"
msgid "Exit"
msgstr "Beenden"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Beenden ohne zu speichern "

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "FPC-SVN-Quelltextverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Verzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi-5-Compilervorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi-5-Verzeichnisvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi-5-Projektvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi-6-Compilervorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi-6-Verzeichnisvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi-6-Projektvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi-7-Compilervorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi-7-Verzeichnisvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi-7-Projektvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Free-Pascal-Compilervorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Free-Pascal-Projektvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Free-Pascal-SVN-Quellenverzeichnis einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3-Compilervorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix-3-Verzeichnisvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix-3-Projektvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem
msgid "Insert Lazarus Directory Template"
msgstr "Lazarus-Verzeichnisvorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Knoten als Kind einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Knoten darunter einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Vorlage einfügen"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Ungültiger Vorfahr"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Ungültiger Elternknoten"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Ungültiger Vorgängerknoten"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Das %s Hauptverzeichnis%sin dem Borland alle %s Quellen installiert hat,%s.Beispielsweise /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Das %s Hauptverzeichnis,%sin dem Borland alle %s Quellen installiert hat,%sdie von diesem %s-Projekt verwendet werden.%sBeispielsweise: /home/user/kylix/%s"

#: lazarusidestrconsts.liscodetoolsdefslazarusdirectory
msgid "Lazarus Directory"
msgstr "Lazarus-Verzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Knoten nach unten bewegen"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Knoten eine Ebene nach unten bewegen"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Knoten eine Ebene nach oben bewegen"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Knoten nach obenbewegen"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Name:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Neuer Knoten"

#: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly
msgid "Node and its children are only valid for this project"
msgstr "Der Knoten und seine Nachfahren sind nur für dieses Projekt gültig"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Knoten ist schreibgeschützt"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Nichts ausgewählt"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node can not contain child nodes."
msgstr "Elternknoten kann keine Kindknoten enthalten."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Der vorherige Knoten kann keine Tochterknoten enthalten."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Projektverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "%s Projektverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsprojectspecific
msgid "%s, project specific"
msgstr "%s, projektspezifisch"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Lesefehler"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Speichern und Ende"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Gewählter Knoten:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging."
msgstr "Das Free-Pascal-SVN-Quellverzeichnis. Nicht unbedingt benötigt. Diese Angaben verbessert das Finden von Deklarationen und das Debugging."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Das Free-Pascal-Projektverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Das Free-Pascal-SVN-Quellverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory
msgid "The Lazarus main directory."
msgstr "Das Lazarus-Hauptverzeichnis"

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Der Pfad zum Free Pascal-Compiler.%s Zum Beispiel %s/usr/bin/%s -n%s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Der Pfad zum Free-Pascal-Compiler für dieses Projekt. Nur benötigt, wenn unten die FPC-SVN-Quelle gesetzt ist. Wird verwendet, um Makros automatisch zu erzeugen."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Das %s Projektverzeichnis,%sdas die .dpr- und dpk-Datei enthält."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Zurücksetzen"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Alles zurücksetzen"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Rekursion zurücknehmen"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Werte als Dateipfade"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Wert als Text"

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variable:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Schreibfehler"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "@"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Klammer"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Doppelpunkt"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Komma"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Bezeichner"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Schlüsselwort"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Zeilenumbruch"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Keine"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Zahl"

#: lazarusidestrconsts.liscodetoolsoptsok
msgctxt "lazarusidestrconsts.liscodetoolsoptsok"
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Punkt"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Strichpunkt"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Leerzeichen"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Stringkonstante"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbol"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Nachher ausführen"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Vorher ausführen"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Alle Klassen einfalten"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Alle Packages einklappen"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Alle Units einklappen"

#: lazarusidestrconsts.liscommandafter
msgid "Command after"
msgstr "Befehl danach"

#: lazarusidestrconsts.liscommandafterinvalid
msgid "Command after invalid"
msgstr "Befehl danach ist ungültig"

#: lazarusidestrconsts.liscommandafterpublishingmodule
msgid "Command after publishing module"
msgstr "Auszuführender Befehl nach Veröffentlichung"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Kommandozeilenparameter des Programms"

#: lazarusidestrconsts.liscompileidewithoutlinking
msgid "Compile IDE (without linking)"
msgstr "IDE kompilieren (ohne Linken)"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compiler"

#: lazarusidestrconsts.liscompilererror
msgid "Compiler error"
msgstr "Compilerfehler"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Fehler: Ungültiger Compiler: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Compilerdateiname"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path"
msgstr "Anmerkung: Sie setzen den Compilerpfad in Einstellungen->Umgebungseinstellungen->Dateien->Compilerpfad"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "Hinweis: CodeTools-Konfigurationsdatei nicht gefunden - verwende Voreinstellungen"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "Hinweis: Lade alte Einstellungsdatei der CodeTools: "

#: lazarusidestrconsts.liscompileroptionsforproject
msgid "Compiler Options for Project: %s"
msgstr "Compilereinstellungen für Projekt: %s"

#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (Kompilieren...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Lange Zeilen-Hinweise anzeigen"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr ""

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nie"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr ""

#: lazarusidestrconsts.liscomponent
msgid "Component"
msgstr "Komponente"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a pascal keyword."
msgstr ""

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name %s%s%s is keyword"
msgstr "Der Komponentenname %s%s%s ist ein Schlüsselwort"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name %s%s%s is not a valid identifier"
msgstr "Der Komponentenname %s%s%s ist als Bezeichner ungültig"

#: lazarusidestrconsts.liscomppalfindcomponent
msgid "Find component"
msgstr "Komponente finden"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Package  öffnen"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Unit öffnen"

#: lazarusidestrconsts.liscomptest
#| msgid "Test"
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Bedingung"

#: lazarusidestrconsts.lisconditionals
msgid "Conditionals:"
msgstr "Bedingungen:"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus-Konfigurationsverzeichnis"

#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Neukompilieren von %s einrichten"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure %sBuild Lazarus%s"
msgstr "%sLazarus kompilieren%s einstellen"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus wird neu erstellt mit den folgenden Profilen:%sFortsetzen?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Änderungen bestätigen"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Löschen bestätigen"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#| msgid "Do you want to rebuild Lazarus?"
msgid "Do you want to rebuild Lazarus with profile: %s ?"
msgstr "Wollen Sie Lazarus mit Profil %s neu kompilieren?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Bestätigen Sie das neue Package-Set für die IDE"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Aktion"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Neues Package-Set"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Altes Package-Set"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konsolenanwendung"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Konstruktor-Code"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "enthält"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Kontextabhängig"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Fortsetzen"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Fortsetzen und nicht mehr nachfragen"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Fortsetzen das Form zu laden"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Mitwirkende"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Komponente benötigt Vorgänger"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr ""

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiaborted
msgid "Aborted."
msgstr "Abgebrochen."

#: lazarusidestrconsts.lisconvdelphiallsubdirectorieswillbescannedforunitfiles
msgid "All sub-directories will be scanned for unit files"
msgstr "Alle Unterverzeichnisse werden nach Unit-Dateien durchsucht"

#: lazarusidestrconsts.lisconvdelphiatthispointthereshouldbenomissingunits
msgid "At this point there should be no missing units!"
msgstr "Jetzt sollte es keine fehlenden Units mehr geben!"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr ""

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Kategorien:"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Konvertierung abgebrochen."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Delphi-Package konvertieren"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Delphi-Projekt konvertieren"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Delphi-Unit konvertieren"

#: lazarusidestrconsts.lisconvdelphiconvertingunitfile
msgid "Converting unit file %s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiconvertingunitfiles
msgid "*** Converting unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphidelphipackagemainsourcedpkfilenotfoundforpackage
msgid "Delphi package main source (.dpk) file not found for package%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Fehler=\"%s\""

#: lazarusidestrconsts.lisconvdelphierrorcantfindunit
msgid "%s(%s,%s) Error: Can't find unit %s"
msgstr "%s(%s,%s) Fehler: Kann Unit %s nicht finden"

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Unitkonvertierung fehlgeschlagen"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit%s%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifindallunitfiles
msgid "*** Find all unit files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Delphi Funktion"

#: lazarusidestrconsts.lisconvdelphikeepboth
msgid "Keep both"
msgstr "Beide behalten"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) fehlende Include-Datei"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Delphi Name"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiready
msgid "Ready."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovedusedunitsinusessection
msgid "Removed used unit \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovefirst
msgid "Remove first"
msgstr ""

#: lazarusidestrconsts.lisconvdelphiremovesecond
msgid "Remove second"
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfile
msgid "Repairing form file %s"
msgstr "Repariere Form-Datei %s"

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Repairing form files... ***"
msgstr ""

#: lazarusidestrconsts.lisconvdelphireplacedunitswithsinusessection
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiskipthisfile
msgid "Skip this file"
msgstr "Diese Datei überspringen"

#: lazarusidestrconsts.lisconvdelphiskipthisstep
msgid "Skip this step"
msgstr "Diesen Schritt überspringen"

#: lazarusidestrconsts.lisconvdelphisomeunitsofthedelphipackagearemissing
msgid "Some units of the Delphi package are missing:%s%s"
msgstr ""

#: lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname
msgctxt "lazarusidestrconsts.lisconvdelphitherearetwounitswiththesameunitname"
msgid "There are two units with the same unitname:%s%s%s%s%s"
msgstr "Es gibt zwei Units mit dem selben Namen:%s%s%s%s%s"

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Es gibt bereits ein Package namens \"%s\"%sBitte schließen sie zuerst dieses Package."

#: lazarusidestrconsts.lisconvdelphiunitnameexiststwice
msgid "Unitname exists twice"
msgstr "Unitname existiert doppelt"

#: lazarusidestrconsts.lisconvdelphiunitsnotfound
msgid "Units not found"
msgstr "Units nicht gefunden"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Units zum Ersetzen in %s"

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Konvertierungsfehler"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Umwandeln"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert encoding"
msgstr "Kodierung umwandeln"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Kodierung von Projekten/Packages umwandeln"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Projekt oder Package umwandeln"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr ""

#: lazarusidestrconsts.lisconverttargetlaz
#| msgid "Lazarus / LCL"
msgctxt "lazarusidestrconsts.lisconverttargetlaz"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lisconverttargetlazanddelphi
#| msgid "Lazarus / LCL for Windows only"
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphi"
msgid "Lazarus and Delphi"
msgstr "Lazarus und Delphi"

#: lazarusidestrconsts.lisconverttargetlazanddelphisamedfm
msgctxt "lazarusidestrconsts.lisconverttargetlazanddelphisamedfm"
msgid "Lazarus and Delphi with same DFM file"
msgstr "Lazarus und Delphi mit derselben DFM-Datei"

#: lazarusidestrconsts.lisconverttargetlazwinonly
#| msgid "Both Lazarus / LCL and Delphi"
msgctxt "lazarusidestrconsts.lisconverttargetlazwinonly"
msgid "Lazarus for Windows only"
msgstr "Lazarus (nur für Windows)"

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Funktionsersetzungen"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Einige Delphi Funktionen können mit LCL Funktionen ersetzt werden"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funktionen / Prozeduren zum Entfernen"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr ""

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Neuer Name"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr ""

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr ""

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Ersatz-Datentypen"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Unbekannte Typen in Formulardatei (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Zu ersetzende Datentypen"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Ersatz-Units"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr ""

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Zu ersetzende Units"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Unbekannte Eigenschaften"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Alle &kopieren"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy all items to clipboard"
msgstr "Alle Einträge in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Alle Ausgaben in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyallshownandhiddenmessagestoclipboard
msgid "Copy all shown and hidden messages to clipboard"
msgstr "Alle gezeigten und verborgenen Meldungen in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy all shown messages to clipboard"
msgstr "Alle gezeigten Meldungen in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Beschreibung in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Kopierfehler"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Kopierfehler"

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy %s%s%s to clipboard"
msgstr "Kopiere %s%s%s in die Zwischenablage"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Kopieren eines ganzen Formulars ist nicht implementiert"

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy item to clipboard"
msgstr "Eintrag in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy selected items to clipboard"
msgstr "Ausgewählte Einträge in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy selected messages to clipboard"
msgstr "Gewählte Meldungen in die Zwischenablage kopieren"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Nach FPC-Meldungen durchsuchen"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Nach Make-Meldungen durchsuchen"

#: lazarusidestrconsts.liscoshowallmessages
msgid "Show all messages"
msgstr "Alle Meldungen anzeigen"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling Compiler"
msgstr "Aufruf des Compilers übergehen"

#: lazarusidestrconsts.liscotargetosspecificoptions
msgid "Target OS specific options"
msgstr "Zielbetriebssystemspezifische Einstellungen"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add %s{$I %s%s} to main source!"
msgstr "Konnte %s{$I %s%s} nicht zum Hauptquelltext hinzufügen!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add %s{$R %s%s} to main source!"
msgstr "Konnte %s{$R %s%s} nicht zum Hauptquelltext hinzufügen!"

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add %s%s%s to main source!"
msgstr "Konnte %s%s%s nicht zum Hauptquelltext hinzufügen!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove %s%s%s from main source!"
msgstr "Konnte %s%s%s nicht aus dem Hauptquelltext entfernen!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove %s{$I %s%s} from main source!"
msgstr "Konnte %s{$I %s%s} nicht aus dem Hauptquelltext entfernen!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove %s{$R %s%s} from main source!"
msgstr "Konnte %s{$R %s%s} nicht aus dem Hauptquelltext entfernen!"

#: lazarusidestrconsts.liscovarious
msgid "%s (various)"
msgstr "%s (verschiedene)"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Warnung: Die zusätzliche Compilerkonfigurationsdatei besitzt den gleichen Namen wie eine der Standard-Konfigurationsdateien nach denen FPC sucht. Das kann dazu führen, daß NUR diese und nicht die Standard-Datei verwendet wird."

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Package %s öffnen"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Unit %s öffnen"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Erzeugen Sie zuerst ein Projekt!"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Verzeichnis anlegen?"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Funktion anlegen"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Hilfe-Knoten anlegen"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Anlegen"

#: lazarusidestrconsts.liscreatenewproject
msgid "Create new project"
msgstr "Neues Projekt beginnen"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Projekt anlegen"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr ".po Datei beim Speichern einer lfm Datei erstellen/aktualisieren"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Erzeuge Datei-Index des FPC-Quelltextverzeichnisses %s ..."

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Verzeichnis auswählen"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "CodeTools-Verzeichniswerte"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Vorlagen definieren"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Keine Variable gewählt>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Vorschau öffnen"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Werkzeuge"

#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variable: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Variablenname"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Vorlagen"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "Bitte wählen Sie ein Makro aus"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Code-Makro auswählen"

#: lazarusidestrconsts.liscurrent
msgid "Current"
msgstr "Aktuell"

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Cursor-Spalte im aktuellem Editor"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Cursor-Zeile im aktuellem Editor"

#: lazarusidestrconsts.liscustombuildmacros
msgid "Custom build macros"
msgstr "Maßgeschneiderte Erstellmakros"

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "Benutzerdefinierte Einstellungen"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Benutzerdefinierte Einstellungen"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Benutzerdefiniertes Programm"

#: lazarusidestrconsts.liscustomprogramafreepascalprogram
#| msgid "Custom Program%sA freepascal program."
msgid "Custom Program%sA Free Pascal program."
msgstr "Benutzerdefiniertes Programm%sEin Free-Pascal-Programm."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Datenmodul"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Datum"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Alle löschen"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Alle löschen"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Alle deaktivieren"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Alle deaktivieren"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Alle aktivieren"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Alle aktivieren"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to clipboard"
msgstr "In Zwischenablage kopieren"

#: lazarusidestrconsts.lisdbgitemdelete
msgctxt "lazarusidestrconsts.lisdbgitemdelete"
msgid "Delete"
msgstr "Löschen"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Löschen"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Deaktivieren"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Deaktivieren"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Aktivieren"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Aktivieren"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Kein Debugger angegeben"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Haltepunkt trotzdem setzen"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu."
msgstr "Es ist kein Debugger angegeben.%sDas Setzen von Haltepunkten ist wirklungslos solange nicht im Debugger-Einstellungsdialog im Menü ein Debugger festgelegt ist."

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "An/Aus"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr ""

#: lazarusidestrconsts.lisdebuggererror
msgid "Debugger error"
msgstr "Debuggerfehler"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Debuggerfehler%sDer Debugger ist abgestürzt.%sSpeichern Sie Ihre Arbeit!%sDrücken Sie »Ok« und hoffen Sie auf einen Fix für diesen Fehler."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Debugger ungültig"

#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (Debuggen...)"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Ausnahme hinzufügen"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Zusätzlicher Suchpfad"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Haltepunkt"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Protokoll beim Start löschen"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Debugger"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Allgemeine Debuggereinstellungen"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Spezifische Debuggereinstellungen (abhängig vom Typ des Debuggers)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Doppelte Ausnahmebezeichnung"

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Name der Ausnahme eingeben"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Ereignisprotokoll"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Behandelt von"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Vom Debugger behandelt"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Vom Programm behandelt"

#: lazarusidestrconsts.lisdebugoptionsfrmid
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Diese Ausnahmen übergehen"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Sprach-Ausnahmen"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit linecount to"
msgstr "Zeilenzählung begrenzen auf"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name"
msgstr "Name"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Lazarus Exceptions"
msgstr "Bei Lazarus-Ausnahmen benachrichtigen"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Betriebssystem-Ausnahmen"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Ausgabe"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Prozeß"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Fortsetzen"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Behandelt fortsetzen"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Unbehandelt fortsetzen"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Meldung beim Anhalten anzeigen"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signale"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"

#: lazarusidestrconsts.lisdebugoptionsfrmwindow
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmwindow"
msgid "Window"
msgstr "Fenster"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Datei kann nicht geladen werden"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file %s%s%s."
msgstr "Datei %s%s%s kann nicht geladen werden."

#: lazarusidestrconsts.lisdecimal
msgid "Decimal"
msgstr "Dezimal"

#: lazarusidestrconsts.lisdefaultvalue
msgid "Default value"
msgstr "Voreinstellung"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Verzögerung für lange Zeilenhinweise in Vervollständigungsbox"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Verzögerung für Hinweise und Vervollständigung"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Alle &löschen"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Alle Haltepunkte löschen?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file %s%s%s?"
msgstr "Alle Haltepunkte in der Datei %s%s%s löschen?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Alle in der gleichen Quelle löschen"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Alle gewählten Haltepunkte löschen?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Alle diese Dateien löschen?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Mehrdeutige Datei löschen?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Haltepunkt löschen"

#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Haltepunkt bei %s»%s«, Zeile %d löschen?"

#: lazarusidestrconsts.lisdeletebuildmacro
msgid "Delete build macro %s%s%s?"
msgstr "Erstellmakro %s%s%s löschen?"

#: lazarusidestrconsts.lisdeletebuildmode
msgid "Delete build mode"
msgstr "Kompilierungsmodus löschen"

#: lazarusidestrconsts.lisdeletebuildmode2
msgid "Delete build mode?"
msgstr "Kompilierungsmodus löschen?"

#: lazarusidestrconsts.lisdeletebuildmode3
msgid "Delete build mode %s%s%s?"
msgstr "Kompilierungsmodus %s%s%s löschen?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Löschen der Datei fehlgeschlagen"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro %s"
msgstr "Lösche Makro %s"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Lösche Modus \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file %s%s%s?"
msgstr "Alte Datei %s%s%s löschen?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Alte Datei löschen?"

#: lazarusidestrconsts.lisdeleterow
msgid "Delete row"
msgstr "Zeile löschen"

#: lazarusidestrconsts.lisdeleteselectedfiles
msgid "Delete selected files"
msgstr "Gewählte Dateien löschen"

#: lazarusidestrconsts.lisdeletesetting
msgid "Delete setting"
msgstr "Einstellung löschen"

#: lazarusidestrconsts.lisdeletesetting2
msgid "Delete setting?"
msgstr "Einstellung löschen?"

#: lazarusidestrconsts.lisdeletesetting3
msgid "Delete setting %s%s%s?"
msgstr "Einstellung %s%s%s löschen?"

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value %s%s%s"
msgstr "Wert %s%s%s löschen"

#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Lösche Wert %s"

#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file %s%s%s failed."
msgstr "Löschen der Datei %s%s%s ist fehlgeschlagen."

#: lazarusidestrconsts.lisdelphi
msgid "Delphi"
msgstr "Delphi"

#: lazarusidestrconsts.lisdelphipackage
msgid "Delphi package"
msgstr "Delphi-Package"

#: lazarusidestrconsts.lisdelphiproject
msgid "Delphi project"
msgstr "Delphi-Projekt"

#: lazarusidestrconsts.lisdelphiunit
msgid "Delphi unit"
msgstr "Delphi-Unit"

#: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename
msgid "There is already another component with the name %s%s%s."
msgstr "Es gibt schon eine Komponente mit dem Namen %s%s%s."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Zielverzeichnis"

#: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete
msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path."
msgstr "Zielverzeichnis %s%s%s ist ungültig.%sBitte wählen Sie einen kompletten Pfad."

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Destruktor-Code"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Schreibweise übergehen"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Zufügen und Löschen leerer Zeilen übergehen"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Unterschiedliche Zeilenenden (z.B. #10 = #13#10) übergehen"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Zahl der Leerzeichen übergehen"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Leerzeichen übergehen (Zeilenumbruchzeichen nicht enthalten)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Leerzeichen am Ende der Zeile übergehen"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Leerzeichen am Beginn der Zeile übergehen"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Nur Auswahl"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open Diff in editor"
msgstr "Öffne Vergleich im Editor"

#: lazarusidestrconsts.lisdiffdlgtext1
msgid "Text1"
msgstr "Text1"

#: lazarusidestrconsts.lisdiffdlgtext2
msgid "Text2"
msgstr "Text2"

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Ziffern:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Anweisungen"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Direktiven für neue Unit"

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory %s%s%s not found."
msgstr "Verzeichnis %s%s%s nicht gefunden."

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Verzeichnis nicht beschreibbar"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Verzeichnis wo die IDE die .po Dateien ablegt"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Alle Haltepunkte in der gleichen Datei abschalten"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Haltepunkt deaktivieren"

#: lazarusidestrconsts.lisdisabled
msgid "Disabled"
msgstr "Ausgeschaltet"

#: lazarusidestrconsts.lisdisablegroup
msgid "Disable Group"
msgstr "Gruppe ausschalten"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "i18n für LFM deaktivieren"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto address"
msgstr "Gehe zu Adresse"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto address"
msgstr "Gehe zu Adresse"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto current address"
msgstr "Gehe zu aktueller Adresse"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto current address"
msgstr "Gehe zu aktueller Adresse"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Änderungen verwerfen"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Alle Änderungen verwerfen"

#: lazarusidestrconsts.lisdiskdiffchangedfiles
msgid "Changed files:"
msgstr "Geänderte Dateien:"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Klicken Sie auf einen der obigen Einträge, um den Vergleich anzuzeigen"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Fehler beim Lesen der Datei: %s"

#: lazarusidestrconsts.lisdiskdiffignorediskchanges
msgid "Ignore disk changes"
msgstr "Änderungen auf dem Datenträger übergehen"

#: lazarusidestrconsts.lisdiskdiffrevertall
msgid "Reload from disk"
msgstr "Erneut von Datenträger laden"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Dateien auf dem Datenträger wurden geändert:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Groß- und Kleinschreibung unterscheiden"

#: lazarusidestrconsts.lisdocumentationeditor
msgid "Documentation Editor"
msgstr "Dokumentationseditor"

#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exists: %s"
msgstr "%s nicht verfügbar: %s"

#: lazarusidestrconsts.lisdonotclosetheide
msgid "Do not close the IDE"
msgstr "IDE nicht schließen"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Schließen Sie das Projekt nicht"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "Abhängigkeiten nicht kompilieren"

#: lazarusidestrconsts.lisdonotinstall
msgid "Do not install"
msgstr "Nicht installiert"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Startbildschirm nicht anzeigen"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr ""

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Diese Nachricht nicht mehr anzeigen"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Gitterlinien zeichnen"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Ausgewählte Komponenten in die Zwischenablage kopieren"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Ausgewählte Komponenten in die Zwischenablage ausschneiden"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Komponente um eins nach hinten bewegen"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Komponente um eins nach vorn bewegen"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Komponente nach hinten bewegen"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Komponente nach vorn bewegen"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Ausgewählte Komponenten aus der Zwischenablage einfügen"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Elternkomponente auswählen"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value %s%s%s."
msgstr "Duplikat des Werts %s%s%s gefunden."

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s"
msgstr "Doppelter Name: Eine Komponente namens %s%s%s existiert bereits in der ererbten Komponente %s"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Suchpfad duplizieren"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Kontexthilfe bearbeiten"

#: lazarusidestrconsts.lisedoptschoosescheme
msgid "Choose Scheme"
msgstr "Schema auswählen"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Alle Packages"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Aktuelles Projekt"

#: lazarusidestrconsts.lisedtdefcurrentprojectdirectory
msgid "Current Project Directory"
msgstr "Aktuelles Projektverzeichnis"

#: lazarusidestrconsts.lisedtdefglobalsourcepathaddition
msgid "Global Source Path addition"
msgstr "Dem globalen Suchpfad zufügen"

#: lazarusidestrconsts.lisedtdefprojectincpath
msgid "Project IncPath"
msgstr "Projekt-Includepfad"

#: lazarusidestrconsts.lisedtdefprojectsrcpath
msgid "Project SrcPath"
msgstr "Projekt-Quellpfad"

#: lazarusidestrconsts.lisedtdefprojectunitpath
msgid "Project UnitPath"
msgstr "Projekt-Unitpfad"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Alle Projekte"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "Delphi-Kompatibilitätsmodus setzen"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "FPC-Modus auf FPC setzen"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "GPC-Kompatibilitätsmodus setzen"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "FPC-Modus auf MacPas setzen"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "Turbo-Pascal-Kompatibilitätsmodus setzen"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "Ein-/Ausgabeüberprüfungen (IOCHECK) aktivieren"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "Überlaufprüfungen (OVERFLOWCHECK) aktivieren"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "Bereichsprüfungen (RANGECHECK) aktivieren"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "Unit HeapTrc einbinden"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "Unit LineInfo einbinden"

#: lazarusidestrconsts.lisedtexttoolalt
msgctxt "lazarusidestrconsts.lisedtexttoolalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Ein gültiges Werkzeug benötigt wenigstens einen Namen und eine auszuführende Datei."

#: lazarusidestrconsts.lisedtexttoolctrl
msgctxt "lazarusidestrconsts.lisedtexttoolctrl"
msgid "Ctrl"
msgstr "Strg"

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Werkzeug bearbeiten"

#: lazarusidestrconsts.lisedtexttoolhidemainform
msgid "Hide main form"
msgstr "Hauptformular verbergen"

#: lazarusidestrconsts.lisedtexttoolinsert
msgid "Insert"
msgstr "Einfügen"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Taste"

#: lazarusidestrconsts.lisedtexttoolmacros
msgid "Macros"
msgstr "Makros"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parameter:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Programmdateiname:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for Free Pascal Compiler messages"
msgstr "Scannen der Ausgabe nach Free Pascal-Compilermeldungen"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for make messages"
msgstr "Ausgabe nach Make-Meldungen durchsuchen"

#: lazarusidestrconsts.lisedtexttoolshift
msgctxt "lazarusidestrconsts.lisedtexttoolshift"
msgid "Shift"
msgstr "Umsch"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titel und Dateiname benötigt"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Arbeitsverzeichnis:"

#: lazarusidestrconsts.lisemdall
msgid "All"
msgstr "Alle"

#: lazarusidestrconsts.lisemdemtpymethods
msgid "Emtpy Methods"
msgstr "Leere Methoden"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Leere Methoden gefunden:"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Nur Published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Methoden entfernen"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "In diesen Klassenbereichen suchen:"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Leer"

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "Alle &zulassen"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Alle in der gleichen Quelle zulassen"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Haltepunkt aktivieren"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Eingeschaltet"

#: lazarusidestrconsts.lisenablegroup
msgid "Enable Group"
msgstr "Gruppe zulassen"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Unterstützung für Internationalisierung und Übersetzung aktivieren"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Makros einschalten"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Einschließen"

#: lazarusidestrconsts.lisencloseselection
msgctxt "lazarusidestrconsts.lisencloseselection"
msgid "Enclose Selection"
msgstr "Auswahl einbeziehen"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Die Kodierung der Datei %s%s%s%sauf dem Datenträger ist %s. Neue Kodierung ist %s."

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2"
msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s."
msgstr "Kodierung der Datei %s%s%s%saus der Platte ist %s. Die neue Kodierung ist %s."

#: lazarusidestrconsts.lisentertransla
msgid "Enter translation language"
msgstr "Übersetzungssprache angeben"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Umgebungsvariable, Name als Parameter"

#: lazarusidestrconsts.lisenvjumpfrommessagetosrcondblclickotherwisesingleclick
msgid "Jump from message to source line on double click (otherwise: single click)"
msgstr "Von der Meldung zur Codezeile springen bei Doppelklick (ansonst: Klick)"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Verzeichnis nicht gefunden"

#: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg
msgid "FPC source directory \"%s\" not found."
msgstr "FPC-Quelltextverzeichnis »%s« nicht gefunden."

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename
msgid "Invalid compiler filename"
msgstr "Ungültiger Compilerdateiname"

#: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg
msgid "The compiler file \"%s\" is not an executable."
msgstr "Die Compilerdatei »%s« ist nicht ausführbar."

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Ungültiger Debuggerdateiname"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Die Debugger-Datei »%s« ist nicht ausführbar."

#: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir
#, fuzzy
#| msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ."
msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl/inc, packages/fcl-base, ... ."
msgstr "Das FPC-Quellverzeichnis »%s« sieht verkehrt aus. Es sollte Verzeichnisse wie rtl, packages, compiler usw. enthalten ..."

#: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir
msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ."
msgstr "Das Lazarus-Verzeichnis »%s« sieht verkehrt aus. Normalerweise enthält es Verzeichnisse wie lcl, debugger, designer, components, ... ."

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilename
msgid "Invalid make filename"
msgstr "Ungültiger Make-Dateiname"

#: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg
msgid "The make file \"%s\" is not an executable."
msgstr "Die Make-Datei »%s« ist nicht ausführbar."

#: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg
msgid "Lazarus directory \"%s\" not found."
msgstr "Lazarus-Verzeichnis »%s« nicht gefunden."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Testverzeichnis »%s« nicht gefunden."

#: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow
msgid "NOTE: only absolute paths are supported now"
msgstr "Hinweis: momentan werden nur absolute Pfade unterstützt"

#: lazarusidestrconsts.liseotabwidths
msgctxt "lazarusidestrconsts.liseotabwidths"
msgid "Tab widths"
msgstr "Tabulatorsprung"

#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Ungültige Einstellung bei %d: »%s«"

#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Die Einstellung an %s erlaubt keinen Parameter: %s"

#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Die Einstellung an %s benötigt einen Parameter: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Fehler: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Fehler beim Erzeugen der Datei"

#: lazarusidestrconsts.liserrorcreatinglrs
msgid "Error creating lrs"
msgstr "Fehler beim Erzeugen der lrs-Datei"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Fehler beim Löschen der Datei"

#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Fehler in %s"

#: lazarusidestrconsts.liserrorinitializingprogramserrors
msgid "Error initializing program%s%s%s%s%sError: %s"
msgstr "Fehler beim Initialisieren des Programms%s%s%s%s%sFehler: %s"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Fehler beim Dateiladen"

#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":%s%s"
msgstr "Fehler beim Laden von \"%s\":%s%s"

#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Fehler beim Laden von %s aus %s%s%s%s"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Fehler beim Verschieben der Komponente"

#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Fehler beim Verschieben der Komponente %s:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Fehler beim Benennen der Komponente"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Fehler beim Öffnen der Komponente"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Fehler beim Parsen des lfm-Komponenten-Streams."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Fehler beim Lesen der Package-Liste aus der Datei%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Fehler beim XML-Lesen"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file %s%s%s%s%s"
msgstr "Fehler beim Lesen der XML-Datei %s%s%s%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Fehler beim Umbenennen der Datei"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Fehler"

#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Fehler beim Speichern von %s nach %s%s%s%s"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Fehler beim Festlegen des Names einer Komponente %s to %s"

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Fehler beim Schreiben der Package-Liste in die Datei%s%s%s%s"

#: lazarusidestrconsts.liseteditcustomscanners
msgid "Edit custom scanners (%s)"
msgstr "Benutzerdefinierte Scanner (%s)"

#: lazarusidestrconsts.lisevalexpression
msgid "Eval expression"
msgstr "Ausdruck berechnen"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "Berechnen"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number:"
msgstr "Jede n-te Zeile:"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Beispieldatei:"

#: lazarusidestrconsts.lisexamples
msgid "Examples"
msgstr "Beispiele"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Beispiele:%sBezeichner%sTMyEnum.Enum%sUnitname.Bezeichner%s#PackageName.UnitName.Bezeichner"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Debuggerausnahmen-Nachricht"

#: lazarusidestrconsts.lisexcludefilter
msgid "Exclude Filter"
msgstr "Ausschließender Filter"

#: lazarusidestrconsts.lisexcludefilter2
msgid "Exclude filter"
msgstr "Filter ausschließen"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Ausführen des Befehls nach"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Ausführen des Befehls vor"

#: lazarusidestrconsts.lisexecutionpaused
msgid "Execution paused"
msgstr "Ausführung angehalten"

#: lazarusidestrconsts.lisexecutionpausedadress
msgid "Execution paused%s  Address: $%s%s  Procedure: %s%s  File: %s%s(Some day an assembler window might popup here :)%s"
msgstr "Ausführung angehalten%sAdresse: $%s%sProzedur: %s%sDatei:%s%s(TODO: Assembler-Ansicht an dieser Stelle%s"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Ausführung beendet"

#: lazarusidestrconsts.lisexeprograms
msgid "Programs"
msgstr "Programme"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Alle Klassen ausfalten"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Alle Packages ausklappen"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Alle Units ausklappen"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Vollständiger Name der Datei im aktuellen Editor"

#: lazarusidestrconsts.lisexport
msgid "Export ..."
msgstr "Export ..."

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportiere Liste"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Ausdruck:"

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Unit-Pfad erweitern?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extrahieren"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Prozedur extrahieren"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External tools"
msgstr "Externe Werkzeuge"

#: lazarusidestrconsts.lisexttoolfailedtoruntool
msgid "Failed to run tool"
msgstr "Werkzeug konnte nicht gestartet werden"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maximale Zahl von Werkzeugen erreicht"

#: lazarusidestrconsts.lisexttoolmovedown
msgctxt "lazarusidestrconsts.lisexttoolmovedown"
msgid "Down"
msgstr "Runter"

#: lazarusidestrconsts.lisexttoolmoveup
msgctxt "lazarusidestrconsts.lisexttoolmoveup"
msgid "Up"
msgstr "Hoch"

#: lazarusidestrconsts.lisexttoolremove
msgctxt "lazarusidestrconsts.lisexttoolremove"
msgid "Remove"
msgstr "Entfernen"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Es gibt eine Obergrenze von %s Werkzeugen."

#: lazarusidestrconsts.lisexttooltitlecompleted
msgid "\"%s\" completed"
msgstr "»%s« beendet"

#: lazarusidestrconsts.lisexttoolunabletorunthetool
msgid "Unable to run the tool %s%s%s:%s%s"
msgstr "Das Hilfsprogramm %s%s%s kann nicht ausgeführt werden:%s%s"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr ""

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Laden des Status des Faltens fehlgeschlagen"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Designer möglichst selten neu zeichnen"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Zeichne Designerelemente nur wenn unbeschäftigt (reduziert die Prozessorbelastung langsamerer Rechner)"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Datei %s%s%s%s sieht nicht aus wie eine Textdatei.%sTrotzdem öffnen?"

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2"
msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Datei %s%s%s%s sieht nicht aus wie eine Textdatei.%sTrotzdem öffnen?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Dateiendung des Programms"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Dateifilter"

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File %s%s%s has changed. Save?"
msgstr "Datei %s%s%s wurde geändert. Speichern?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Datei gehört zu keinem Projekt"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Datei ist schreibgeschützt"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Datei ist ein symbolischer Link"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File %s%s%s is virtual."
msgstr "Die Datei %s%s%s wurde noch nicht gespeichert."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Datei-Link-Fehler"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Dateiname/Adresse"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Datei nicht gefunden"

#: lazarusidestrconsts.lisfilenotfound2
msgid "File %s%s%s not found.%s"
msgstr "Datei %s%s%s nicht gefunden.%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File %s%s%s not found.%sDo you want to create it?%s"
msgstr "Datei %s%s%s nicht gefunden.%sWollen Sie sie erzeugen%s"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Datei nicht in Kleinbuchstaben"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Keine Textdatei"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings ..."
msgstr "Dateieinstellungen ..."

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Dateien in ASCII- oder UTF-8-Kodierung"

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Dateien sind weder ASCII- nach UTF-8-kodiert"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "Datei, in die Debug-Ausgaben geschrieben werden. Falls nichts angegeben ist, werden Debug-Ausgaben auf die Konsole geschrieben."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filter"

#: lazarusidestrconsts.lisfilter2
msgid "(filter)"
msgstr "(Filter)"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filter: %s"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Filtergruppen"

#: lazarusidestrconsts.lisfindfilecasesensitive
msgid "&Case sensitive"
msgstr "&Klein/groß beachten"

#: lazarusidestrconsts.lisfindfiledirectoryoptions
msgid "Directory options"
msgstr "Verzeichniseinstellungen"

#: lazarusidestrconsts.lisfindfilefilemaskbak
msgid "File mask (*;*.*;*.bak?)"
msgstr "Dateimaske (*;*.*;*.bak?)"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include sub directories"
msgstr "Unterverzeichnisse einbeziehen"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Mehrzeiliges Muster"

#: lazarusidestrconsts.lisfindfileonlytextfiles
msgid "Only text files"
msgstr "Nur Textdateien"

#: lazarusidestrconsts.lisfindfileregularexpressions
msgid "&Regular expressions"
msgstr "&Reguläre Ausdrücke"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Alle &Projektdateien durchsuchen"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "alle &offenen Dateien suchen"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Suche in &Verzeichnissen"

#: lazarusidestrconsts.lisfindfiletexttofind
msgid "Text to find:"
msgstr "Suchtext:"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Wo"

#: lazarusidestrconsts.lisfindfilewholewordsonly
msgid "&Whole words only"
msgstr "&Nur ganze Wörter"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Tastenkombination suchen"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Fehlende Unit suchen"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "als erste"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr ".LFM-Datei korrigieren"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Gleitkomma"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Umbenennen erzwingen"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Form"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Formatfehler"

#: lazarusidestrconsts.lisformloaderror
msgid "Form load error"
msgstr "Formularladefehler"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake fehlgeschlagen"

#: lazarusidestrconsts.lisfpcomponents
msgctxt "lazarusidestrconsts.lisfpcomponents"
msgid "Components"
msgstr "Komponenten"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources"
msgstr "FPC-Ressourcen"

#: lazarusidestrconsts.lisfpcsourcedirectoryerror
msgid "FPC Source Directory error"
msgstr "FPC-Quelltextverzeichnis-Fehler"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC ist zu alt"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "FPC-Version: "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "FPC-Version (z.B. 2.2.4)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "FPDoc-Editor"

#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Fehler beim Schreiben von \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "FPDoc Syntaxfehler"

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Es gibt einen Syntaxfehler im fpdoc Element \"%s\":%s%s"

#: lazarusidestrconsts.lisfpfindpalettecomponent
msgid "Find palette component"
msgstr "Komponente in der Palette finden"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Frame"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Rückwärts suchen"

#: lazarusidestrconsts.lisfreepascal
msgid "Free Pascal"
msgstr "Free Pascal"

#: lazarusidestrconsts.lisfreepascalcompilernotfound
msgid "Free Pascal Compiler not found"
msgstr "Free-Pascal-Compiler nicht gefunden"

#: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych
#, fuzzy
#| msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus."
msgid "Free Pascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program source is automatically maintained by Lazarus."
msgstr "Free-Pascal-Programm auf der Basis von TCustomApplication für das einfache Prüfen von Kommandozeileneinstellungen, Bearbeiten von Ausnahmen und so weiter. Die Programmdatei wird von Lazarus betreut."

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Freepascal source directory"
msgstr "Free-Pascal-Quelltextverzeichnis"

#: lazarusidestrconsts.lisfreepascalsourcefile
msgid "FreePascal source file"
msgstr "Free-Pascal-Quelldatei"

#: lazarusidestrconsts.lisfreepascalsourcesnotfound
msgid "Free Pascal Sources not found"
msgstr "Free-Pascal-Quelltexte nicht gefunden"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "&Vorwärts suchen"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Zusätzliche zu suchende Dateien (z.B. *.pas;*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Bezeichner suchen oder umbenennen"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Referenz suchen"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Bezeichner: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "in allen offenen Packages und Projekten"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "in aktueller Unit"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "Im Hauptprojekt"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "im Projekt/Package, dem die aktuelle Unit gehört"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Ungültiger Bezeichner"

#: lazarusidestrconsts.lisfrirename
msgctxt "lazarusidestrconsts.lisfrirename"
msgid "Rename"
msgstr "Umbenennen"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Umbenennen aller Referenzen"

#: lazarusidestrconsts.lisfrirenameto
msgid "Rename to"
msgstr "Umbenennen in"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Auch in Kommentaren suchen"

#: lazarusidestrconsts.lisfrisearchwhere
msgid "Search where"
msgstr "Wo suchen"

#: lazarusidestrconsts.lisfunction
msgid "Function"
msgstr "Funktion"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "Wort an der aktuellen Cursorposition lesen"

#: lazarusidestrconsts.lisgotoline
msgid "Goto line"
msgstr "Zu Zeile springen"

#: lazarusidestrconsts.lisgotoselectedsourceline
msgctxt "lazarusidestrconsts.lisgotoselectedsourceline"
msgid "Goto selected source line"
msgstr "Zu ausgewählter Quelltextzeile springen"

#: lazarusidestrconsts.lisgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<Beschreibung>%sCopyright (C) <Jahr> <Names des Autors> <Kontakt>%sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Gruppe"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Zum größten hin wachsen"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Besitzt Onlinehilfe"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Header-Kommentar für die Klasse"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Hilfeeinträge"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Hilfe-Wähler"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Hexadezimal"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for FreePascal Compiler message"
msgstr "Hilfe für FreePascal-Compilermeldungen"

#: lazarusidestrconsts.lishidemessageviadirective
msgid "Hide message via directive"
msgstr ""

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr ""

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Hinweis: Prüfen Sie, ob zwei Packages Units mit gleichen Namen enthalten."

#: lazarusidestrconsts.lishintdoubleclickonthecommandyouwanttoedit
msgid "Hint: double click on the command you want to edit"
msgstr "Hinweis: Klicken Sie auf den Befehl, den Sie bearbeiten wollen"

#: lazarusidestrconsts.lishintopen
msgctxt "lazarusidestrconsts.lishintopen"
msgid "Open"
msgstr "Öffnen"

#: lazarusidestrconsts.lishintpause
msgctxt "lazarusidestrconsts.lishintpause"
msgid "Pause"
msgstr "Anhalten"

#: lazarusidestrconsts.lishintrun
msgctxt "lazarusidestrconsts.lishintrun"
msgid "Run"
msgstr "Start"

#: lazarusidestrconsts.lishintsave
msgctxt "lazarusidestrconsts.lishintsave"
msgid "Save"
msgstr "Speichern"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Alles speichern"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Einzelschritt hinein"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Laufen bis die Funktion zurückkehrt"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Einzelschritt darüber"

#: lazarusidestrconsts.lishintstop
msgctxt "lazarusidestrconsts.lishintstop"
msgid "Stop"
msgstr "Halt"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Anmerkung: Die Funktion »Make Resourcestring« erwartet eine Zeichenkettenkonstante.%s Bitte wählen Sie den Ausdruck und versuchen Sie es noch einmal."

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again."
msgstr "Anmerkung: Die Funktion »Make Resourcestring« erwartet eine Zeichenkettenkonstante.%s Bitte wählen Sie nur einen Zeichenkettenausdruck und versuchen Sie es noch einmal."

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Formular/Unit wechseln"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Formulare anzeigen"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Units anzeigen"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Zahl der Treffer"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Datenbanken"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Hilfeeinstellungen"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Eigenschaften"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Betrachter"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC-Doc-HTML-Pfad"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Waagrecht"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Kompilieroptionen der IDE"

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Erzeuge Makedatei für Package %s"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr ""

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informationen über die IDE"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "WARNUNG: Unit-Name ungültig %s, Package=%s"

#: lazarusidestrconsts.lisideintf
msgid "IDE Interface"
msgstr "IDE-Schnittstelle"

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Bezeichner"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Bezeichner beginnt mit ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Bezeichner enthält ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE-Einstellungen"

#: lazarusidestrconsts.lisideprojectdirinidetitle
msgid "Show project directory in IDE title"
msgstr "Projektverzeichnis im IDE-Titel anzeigen"

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "IDE-Titel beginnt mit Projektname"

#: lazarusidestrconsts.lisiecoerroraccessingxml
msgid "Error accessing xml"
msgstr "XML-Zugriffsfehler"

#: lazarusidestrconsts.lisiecoerroraccessingxmlfile
msgid "Error accessing xml file %s%s%s:%s%s"
msgstr "Fehler beim Zugriff auf die XML-Datei %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoerrorloadingxml
msgid "Error loading xml"
msgstr "XML-Ladefehler"

#: lazarusidestrconsts.lisiecoerrorloadingxmlfile
msgid "Error loading xml file %s%s%s:%s%s"
msgstr "Fehler beim Laden der XML-Datei %s%s%s:%s%s"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Zu exportierende Datei ist vorhanden"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Die exportierte Datei %s%s%s ist vorhanden.%sSoll die Datei geöffnet und nur die Compilereinstellungen ersetzt werden?%s(Andere Einstellungen bleiben erhalten.)"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Aus Datei laden"

#: lazarusidestrconsts.lisiecoopenorloadcompileroptions
msgid "Open or Load Compiler Options"
msgstr "Compilereinstellungen öffnen oder laden"

#: lazarusidestrconsts.lisiecoopenrecent
msgid "Open recent"
msgstr "Zuletzt verwendete öffnen"

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Zuletzt verwendete Dateien"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "In Datei sichern"

#: lazarusidestrconsts.lisiecosavetorecent
msgid "Save to recent"
msgstr "Zu den zuletzt geöffneten Dateien hinzufügen"

#: lazarusidestrconsts.lisifdok
msgctxt "lazarusidestrconsts.lisifdok"
msgid "OK"
msgstr "Pk"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Alle übergehen"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Übergehen und fortsetzen"

#: lazarusidestrconsts.lisignorebinaries
msgid "Ignore binaries"
msgstr "Binärdateien übergehen"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Diesen Ausnahmetyp übergehen"

#: lazarusidestrconsts.lisignoremissingfile
msgid "Ignore missing file"
msgstr "Fehlende Datei übergehen"

#: lazarusidestrconsts.lisignoreusetformasancestor
msgid "Ignore, use TForm as ancestor"
msgstr "Übergehen, TForm als Vorfahr verwenden"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Einrückung der aktuellen Unit, des Projekts oder des Packages übernehmen"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Implementierungs-Kommentar für die Klasse"

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importliste"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Unmöglich"

#: lazarusidestrconsts.lisincludefilter
msgid "Include Filter"
msgstr "Maske"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "Include-Pfad"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Include-Pfade"

#: lazarusidestrconsts.lisindentation
msgid "Indentation"
msgstr "Einrückung"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for pascal sources"
msgstr "Einrückung für Pascal Quellcode"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Index"

#: lazarusidestrconsts.lisinfobuildabort
msgid "Aborted..."
msgstr "Abgebrochen..."

#: lazarusidestrconsts.lisinfobuildcaption
msgid "Compile Project"
msgstr "Kompiliere Projekt"

#: lazarusidestrconsts.lisinfobuildcomplile
msgid "Compiling..."
msgstr "Kompilieren..."

#: lazarusidestrconsts.lisinfobuilderror
msgid "Error..."
msgstr "Fehler..."

#: lazarusidestrconsts.lisinfobuilderrors
msgid "Errors:"
msgstr "Fehler:"

#: lazarusidestrconsts.lisinfobuildhint
msgid "Hints:"
msgstr "Hinweise:"

#: lazarusidestrconsts.lisinfobuildlines
msgctxt "lazarusidestrconsts.lisinfobuildlines"
msgid "Lines:"
msgstr "Zeilen:"

#: lazarusidestrconsts.lisinfobuildmakeabort
msgctxt "lazarusidestrconsts.lisinfobuildmakeabort"
msgid "Abort"
msgstr "Alles abbrechen"

#: lazarusidestrconsts.lisinfobuildnote
msgid "Notes:"
msgstr "Bemerkungen:"

#: lazarusidestrconsts.lisinfobuildproject
msgid "Project:"
msgstr "Projekt:"

#: lazarusidestrconsts.lisinfobuildsuccess
msgid "Success..."
msgstr "Erfolg..."

#: lazarusidestrconsts.lisinfobuildwarning
msgid "Warnings:"
msgstr "Warnungen:"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Information"

#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informationen zu %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informationen über verwendeten FPC"

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "vor ähnlichen"

#: lazarusidestrconsts.lisinheritedcomponent
msgid "Inherited Component"
msgstr "Abgeleitete Komponente"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Abgeleiteter Punkt"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?"
msgstr "Um eine saubere Kopie des Projekts oder Packages zu erhalten, werden alle Dateien im folgenden Verzeichnis gelöscht, der gesamte Inhalt geht verloren.%s%sAlle Dateien in %s%s% löschen?"

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Datum einfügen"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Datum und Zeit einfügen"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string"
msgstr "Datum und Zeit einfügen. Optional: Formatstring"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string"
msgstr "Datum einfügen. Optional: Formatstring"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "End bei Bedarf einfügen"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Makro einfügen"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure"
msgstr "Name der aktuellen Prozedur eintragen"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Druckkürzel eintragen"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Druckkürzel eintragen"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Prozedurkopf einfügen"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Prozedurname einfügen"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "Zeit einfügen"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string"
msgstr "Zeit einfügen. Optional: Formatstring"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "URL-Tag einfügen"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr ""

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "Überprüfung"

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Daten"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Debug-Inspektor"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Methoden"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Properties"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Installation fehlgeschlagen"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr ""

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Auswahl installieren"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall packages"
msgstr ""

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interaktiv"

#: lazarusidestrconsts.lisinvalidbuildmacrothebuildmacromustbeapascalidentifie
msgid "Invalid build macro %s%s%s. The build macro must be a pascal identifier."
msgstr "Ungültiges Erstellmakro %s%s%s. Das Erstellmakro muß ein Pascal-Bezeichner sein."

#: lazarusidestrconsts.lisinvalidbuildmacrothenameisakeyword
msgid "Invalid build macro \"%s\". The name is a keyword."
msgstr "Ungültiges Erstellmakro \"%s\". Der Name ist ein Schlüsselwort."

#: lazarusidestrconsts.lisinvalidcircle
msgid "Invalid circle"
msgstr "Ungültiger Kreis"

#: lazarusidestrconsts.lisinvalidcommand
msgid "Invalid command"
msgstr "Ungültiger Befehl"

#: lazarusidestrconsts.lisinvalidcompilerfilename
msgid "Invalid Compiler Filename"
msgstr "Ungültiger Name des Compilers"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Ungültiger Löschvorgang"

#: lazarusidestrconsts.lisinvaliddestinationdirectory
msgid "Invalid destination directory"
msgstr "Ungültiges Zielverzeichnis"

#: lazarusidestrconsts.lisinvalidexpression
msgid "Invalid expression:%s%s%s%s"
msgstr "Ungültiger Ausdruck:%s%s%s%s"

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Ungültiger Ausdruck.%sHinweis: Das »Make« für Ressourcenstrings erwartet eine Zeichenkettenkonstante in einer einzelnen Datei. Bitte wählen Sie den Ausdruck und versuchen Sie es noch einmal."

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Ungültiger Filter"

#: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory
msgid "Invalid Free Pascal source directory"
msgstr "Ungültiges Free-Pascal-Quelltextverzeichnis"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr ""

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Ungültiger Modus %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Ungültige Mehrfachauswahl"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Ungültig (Aus)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Ungültig (An)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Ungültiger Pascal-Bezeichner"

#: lazarusidestrconsts.lisinvalidpascalidentifiertext
msgid "The name \"%s\" is not a valid pascal identifier."
msgstr "Der Name »%s« ist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Ungültiger Proc-Name"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Ungültiger Projektdateiname"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Ungültiges Ausgabeverzeichnis"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Ungültige Auswahl"

#: lazarusidestrconsts.lisisagroupasettingcanonlybeaddedtonormalbuildmodes
msgid "%s is a group. A setting can only be added to normal build modes."
msgstr "%s ist eine Gruppe. Eine Einstellung kann nur normalen Kompiliermodi zugefügt werden."

#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s ist bereits im Projekt enthalten."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "%s%s%s ist als Projektname ungültig.%sBitte wählen Sie einen anderen (z.B. project1.lpi)"

#: lazarusidestrconsts.lisisathiscircledependencyisnotallowed
msgid "%s is a %s.%sThis circle dependency is not allowed."
msgstr "%s ist ein %s.%sDiese zirkuläre Abhängigkeit ist nicht erlaubt"

#: lazarusidestrconsts.lisjhjumphistory
msgid "Jump History"
msgstr "Sprungliste"

#: lazarusidestrconsts.lisjitform
msgid "JIT Form"
msgstr "JIT-Form"

#: lazarusidestrconsts.liskeep
msgid "keep"
msgstr "beibehalten"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Konvertierte Dateien im Editor geöffnet halten"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr ""

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "In Installationsliste behalten"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Name behalten"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Beibehalten und fortsetzen"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Benutzerdefinierte Anweisungen"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Designer-Befehle"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Objektinspektorbefehle"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Taste (oder 2-Tasten-Kombination)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Kompilieren abbrechen"

#: lazarusidestrconsts.liskmaddactiveunittoproject
msgid "Add active unit to project"
msgstr "Aktuelle Unit zum Projekt zufügen"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Überwachung hinzufügen"

#: lazarusidestrconsts.liskmbuildallfilesofprojectprogram
msgid "Build all files of project/program"
msgstr "Alle Dateien des Projekts/Programms neu kompilieren"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Projekt/Programm neu kompilieren"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Tastaturbelegungsschema auswählen"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klassisch"

#: lazarusidestrconsts.liskmcloseall
msgid "Close All"
msgstr "Alle auswählen"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Projekt schließen"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Definitioneneditor der Codetools"

#: lazarusidestrconsts.liskmcodetoolsoptions
msgid "CodeTools options"
msgstr "CodeTools-Eigenschaften"

#: lazarusidestrconsts.liskmcompileroptions
msgid "Compiler options"
msgstr "Compilereinstellungen"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config %sBuild File%s"
msgstr "%sNeukompilieren der Datei%s einrichten"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure custom components"
msgstr "Externe Komponenten einrichten"

#: lazarusidestrconsts.liskmconfigurehelp
msgid "Configure Help"
msgstr "Hilfe einrichten"

#: lazarusidestrconsts.liskmconfigureinstalledpackages
#, fuzzy
#| msgid "Configure installed packages"
msgctxt "lazarusidestrconsts.liskmconfigureinstalledpackages"
msgid "Install/Uninstall packages"
msgstr "Installierte Packages einrichten"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Kontextsensitive Hilfe"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Delphi- in Lazarus-Package umwandeln"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi project to Lazarus project"
msgstr "Delphi- in Lazarus-Projekt umwandeln"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi unit to Lazarus unit"
msgstr "Delphi- in Lazarus-Unit umwandeln"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM file to LFM"
msgstr "DFM- in LFM-Datei umwandeln"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected Components to clipboard"
msgstr "Ausgewählte Komponenten in die Zwischenablage kopieren"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected Components to clipboard"
msgstr "Ausgewählte Komponenten in die Zwischenablage ausschneiden"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Letztes Zeichen löschen"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff editor files"
msgstr "Editordateien vergleichen"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Vorlagen bearbeiten"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Kontextsensitive Hilfe bearbeiten"

#: lazarusidestrconsts.liskmeditoroptions
msgctxt "lazarusidestrconsts.liskmeditoroptions"
msgid "Editor options"
msgstr "Editoreigenschaften"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose selection"
msgstr "Bereich einschließen"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Überprüfen/Ändern"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Einstellungen für externe Werkzeuge"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find incremental"
msgstr "Inkrementelle Suche"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to marker 0"
msgstr "Zur 0. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to marker 1"
msgstr "Zur 1. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to marker 2"
msgstr "Zur 2. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to marker 3"
msgstr "Zur 3. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to marker 4"
msgstr "Zur 4. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to marker 5"
msgstr "Zur 5. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to marker 6"
msgstr "Zur 6. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to marker 7"
msgstr "Zur 7. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to marker 8"
msgstr "Zur 8. Markierung gehen"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to marker 9"
msgstr "Zur 9. Markierung gehen"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Zum 1. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Zum 10. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Zum 2. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Zum 3. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Zum 4. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Zum 5. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Zum 6. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Zum 7. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Zum 8. Quelltexteditor gehen"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Zum 9. Quelltexteditor gehen"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Datum und Uhrzeit einfügen"

#: lazarusidestrconsts.liskminsertifdef
msgid "Insert $IFDEF"
msgstr "$IFDEF einfügen"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Username einfügen"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspizieren"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Tastaturbelegung"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus (default)"
msgstr "Lazarus (Voreinstellung)"

#: lazarusidestrconsts.liskmmacosxapple
msgid "Mac OS X (Apple style)"
msgstr "OS X (Apple-Stil)"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "Mac OS X (Lazarus style)"
msgstr "OS X (Lazarus-Stil)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Neues Package"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Neues Projekt"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Neues Projekt aus Datei"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Neue Unit"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nachricht: Alle Tasten werden auf die Werte des gewählten Schemas gesetzt."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Packagedatei öffnen"

#: lazarusidestrconsts.liskmpackagegraph
msgid "Package graph"
msgstr "Package-Graph"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components from clipboard"
msgstr "Komponenten aus der Zwischenablage einfügen"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Programm anhalten"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Projekt veröffentlichen"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Schnelles Kompilieren, kein Linken"

#: lazarusidestrconsts.liskmremoveactiveunitfromproject
msgid "Remove active unit from project"
msgstr "Aktive Unit aus dem Projekt entfernen"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Programm starten"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Alles speichern"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Speichern als"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Projekt speichern"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Projekt speichern als"

#: lazarusidestrconsts.liskmselectlineend
msgid "Select line end"
msgstr "Zeilenende wählen"

#: lazarusidestrconsts.liskmselectlinestart
msgid "Select line start"
msgstr "Zeilenanfang wählen"

#: lazarusidestrconsts.liskmselectpagebottom
msgid "Select page bottom"
msgstr "Seitenende auswählen"

#: lazarusidestrconsts.liskmselectpagetop
msgid "Select page top"
msgstr "Seitenanfang auswählen"

#: lazarusidestrconsts.liskmselectwordleft
msgid "Select word left"
msgstr "Wort links wählen"

#: lazarusidestrconsts.liskmselectwordright
msgid "Select word right"
msgstr "Wort rechts wählen"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Freies Lesezeichen setzen"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set marker 0"
msgstr "Markierung 0 setzen"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set marker 1"
msgstr "Markierung 1 setzen"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set marker 2"
msgstr "Markierung 2 setzen"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set marker 3"
msgstr "Markierung 3 setzen"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set marker 4"
msgstr "Markierung 4 setzen"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set marker 5"
msgstr "Markierung 5 setzen"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set marker 6"
msgstr "Markierung 6 setzen"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set marker 7"
msgstr "Markierung 7 setzen"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set marker 8"
msgstr "Markierung 8 setzen"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set marker 9"
msgstr "Markierung 9 setzen"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop program"
msgstr "Programm stoppen"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Zwischen Unit und Form umschalten"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle marker 0"
msgstr "Markerung 0 umschalten"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle marker 1"
msgstr "Markerung 1 umschalten"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle marker 2"
msgstr "Markerung 2 umschalten"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle marker 3"
msgstr "Markerung 3 umschalten"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle marker 4"
msgstr "Markerung 4 umschalten"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle marker 5"
msgstr "Markerung 5 umschalten"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle marker 6"
msgstr "Markerung 6 umschalten"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle marker 7"
msgstr "Markerung 7 umschalten"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle marker 8"
msgstr "Markerung 8 umschalten"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle marker 9"
msgstr "Markerung 9 umschalten"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgid "Toggle view Assembler"
msgstr "Assembleransicht umschalten"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "Toggle view Breakpoints"
msgstr "Ansicht der Haltepunkte umschalten"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgid "Toggle view Call Stack"
msgstr "Ansicht des Aufrufstacks umschalten"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Ansicht des Code-Explorers umschalten"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle view component palette"
msgstr "Ansicht der Komponentenpalette umschalten"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
#, fuzzy
#| msgid "Toggle view Debug Events"
msgid "Toggle view Debuger Event Log"
msgstr "Ansicht der Debug-Ereignisse umschalten"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "Toggle view Debugger Output"
msgstr "Ansicht der Debugger-Ausgabe umschalten"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Ansicht des Dokumentationseditor umschalten"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Ansicht der  IDE-Speedbuttons umschalten"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "Toggle view Local Variables"
msgstr "Ansicht der lokalen Variablen umschalten"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Ansicht der Meldungen umschalten"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Ansicht des Objektinspektors umschalten"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "Toggle view Registers"
msgstr "Registeransicht umschalten"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Ansicht der Suchergebnisse umschalten"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Ansicht des Quelltexteditors umschalten"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "Toggle view Watches"
msgstr "Ansicht der überwachten Ausdrücke umschalten"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Sprungverlauf anzeigen"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Projekteinstellungen anzeigen"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View project source"
msgstr "Projektquelltext anzeigen"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Unit-Informationen anzeigen"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Startprogramm ungültig"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Startbefehl des Projekts"

#: lazarusidestrconsts.lislazarusdesktopsettings
msgid "Lazarus Desktop Settings"
msgstr "Lazarus-Desktop-Einstellungen"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus Verzeichnis"

#: lazarusidestrconsts.lislazarusdirectorynotfound
msgid "Lazarus directory not found"
msgstr "Lazarus-Verzeichnis nicht gefunden"

#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory, to be used as a basedirectory"
msgstr "Verzeichnis, wird als Basisordner festgelegt"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazarusfile
msgid "Lazarus File"
msgstr "Lazarus-Datei"

#: lazarusidestrconsts.lislazarusform
msgid "Lazarus form"
msgstr "Lazarus-Form"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus-IDE"

#: lazarusidestrconsts.lislazarusinclude
msgid "Lazarus include file"
msgstr "Lazarus-Include-Datei"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus-Sprach-ID (z.B. en, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Name der Sprache für Lazarus (z.B. english, deutsch)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [Einstellungen] <Projektdatei>"

#: lazarusidestrconsts.lislazaruspackage
msgid "Lazarus package"
msgstr "Lazarus-Package"

#: lazarusidestrconsts.lislazarusproject
msgid "Lazarus project"
msgstr "Lazarus-Projekt"

#: lazarusidestrconsts.lislazarusprojectinfofile
msgid "Lazarus Project Info file"
msgstr "Lazarus-Projektinfo-Datei"

#: lazarusidestrconsts.lislazarusprojectsource
msgid "Lazarus project source"
msgstr "Lazarus-Projektquelltext"

#: lazarusidestrconsts.lislazarusunit
msgid "Lazarus unit"
msgstr "Lazarus-Unit"

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Aktion"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Ausgabeverzeichnis der ausführbaren IDE wählen"

#: lazarusidestrconsts.lislazbuildabopart
msgid "Part"
msgstr "Teil"

#: lazarusidestrconsts.lislazbuildadd
msgctxt "lazarusidestrconsts.lislazbuildadd"
msgid "Add"
msgstr "Hinzufügen"

#: lazarusidestrconsts.lislazbuildadvancedbuildoptions
msgid "Advanced Build Options"
msgstr "Erweiterte Compilereinstellungen"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Wollen sie dieses Erstellprofil wirklich löschen?"

#: lazarusidestrconsts.lislazbuildbuild
msgctxt "lazarusidestrconsts.lislazbuildbuild"
msgid "Build"
msgstr "Neukompilieren"

#: lazarusidestrconsts.lislazbuildbuildadvanced
msgctxt "lazarusidestrconsts.lislazbuildbuildadvanced"
msgid "Build Advanced"
msgstr "Mehrere Profile"

#: lazarusidestrconsts.lislazbuildbuildcodetools
msgid "Build CodeTools"
msgstr "Codetools kompilieren"

#: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools
msgid "Build components (SynEdit, CodeTools)"
msgstr "Komponenten  (SynEdit, CodeTools) kompilieren"

#: lazarusidestrconsts.lislazbuildbuildexamples
msgid "Build examples"
msgstr "Beispiele kompilieren"

#: lazarusidestrconsts.lislazbuildbuildide
msgid "Build IDE"
msgstr "IDE kompilieren"

#: lazarusidestrconsts.lislazbuildbuildjitform
msgid "Build JITForm"
msgstr "JIT-Formular kompilieren"

#: lazarusidestrconsts.lislazbuildbuildsynedit
msgid "Build SynEdit"
msgstr "Synedit kompilieren"

#: lazarusidestrconsts.lislazbuildcancel
msgctxt "lazarusidestrconsts.lislazbuildcancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.lislazbuildcleanall
msgid "Clean all"
msgstr "Alles säubern"

#: lazarusidestrconsts.lislazbuildcleanbuild
msgid "Clean+Build"
msgstr "Säubern und neu erzeugen"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Allgemeine Einstellungen"

#: lazarusidestrconsts.lislazbuildcompileselectedstaticpackagesintolazarusbinary
msgid "Compile selected static packages into Lazarus binary"
msgstr "Kompiliert die gewählten statischen Packages in die Lazarus-Binärdatei"

#: lazarusidestrconsts.lislazbuildconfirmbuild
#, fuzzy
#| msgid "Confirm before rebuilding Lazarus"
msgid "Confirm before build"
msgstr "Kompilieren von Lazarus bestätigen "

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Löschung bestätigen"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definitionen"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definitionen ohne -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Bearbeite Definitionen"

#: lazarusidestrconsts.lislazbuildeditdefinesdialogcaption
msgctxt "lazarusidestrconsts.lislazbuildeditdefinesdialogcaption"
msgid "Edit Defines"
msgstr "Bearbeite Definitionen"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Bearbeiten der Liste von Definitionen, die von jedem Profil verwendet werden können"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Fehler beim Schreiben der Datei"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%sLazBuild ist nicht interaktiv, es wird abgebrochen."

#: lazarusidestrconsts.lislazbuildlikemakecleanoncmdline
msgid "Like \"make clean\" on cmd line"
msgstr "Wie \"make clean\" auf Kommandozeile"

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Erstellprofile verwalten"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Profile verwalten"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Name des aktiven Profils"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Neues Profil hinzufügen"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr ""

#: lazarusidestrconsts.lislazbuildnone
msgctxt "lazarusidestrconsts.lislazbuildnone"
msgid "None"
msgstr "Keine"

#: lazarusidestrconsts.lislazbuildok
msgctxt "lazarusidestrconsts.lislazbuildok"
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Einstellungen:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "An den Compiler weitergereichte Einstellungen"

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to Build"
msgstr "Profil zum Kompilieren"

#: lazarusidestrconsts.lislazbuildqbobuildall
msgid "Build All"
msgstr "Alles neu kompilieren"

#: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages
msgid "Build IDE without Packages"
msgstr "IDE ohne Packages neu kompilieren"

#: lazarusidestrconsts.lislazbuildqbobuildidewpackages
msgid "Build IDE with Packages"
msgstr "IDE mit Packages neu kompilieren"

#: lazarusidestrconsts.lislazbuildqbobuildlcl
msgid "Build LCL"
msgstr "LCL neu kompilieren"

#: lazarusidestrconsts.lislazbuildqbocleanupbuildall
msgid "Clean Up + Build all"
msgstr "Aufräumen und neu kompilieren"

#: lazarusidestrconsts.lislazbuildrefresh
msgctxt "lazarusidestrconsts.lislazbuildrefresh"
msgid "Refresh"
msgstr "Erneuern"

#: lazarusidestrconsts.lislazbuildremove
msgctxt "lazarusidestrconsts.lislazbuildremove"
msgid "Remove"
msgstr "Entfernen"

#: lazarusidestrconsts.lislazbuildrename
msgctxt "lazarusidestrconsts.lislazbuildrename"
msgid "Rename"
msgstr "Umbenennen"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Profil umbenennen"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Neuer Name für Profil:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
#, fuzzy
#| msgid "Restart after building the IDE"
msgid "Restart after building IDE"
msgstr "Nach dem Kompilieren neu starten"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomaticallyafterbuildingtheidehasn
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Startet Lazarus nach dem Erstellen der IDE automatisch neu (hat keinen Effekt beim Erstellen anderer Teile)"

#: lazarusidestrconsts.lislazbuildsavesettings
msgid "Save settings"
msgstr "Einstellungen speichern"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Profile zum Erstellen auswählen"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuildingdirectlyfromtool
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Zeigt einen Bestätigungsdialog beim Erstellen aus dem Werkzeuge-Menü heraus"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Ziel-CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Zielverzeichnis:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Zielsystem:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Kann Datei »%s« nicht schreiben: %s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Aktualisiere revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Aktualisiert die Revisions-Info im \"Über Lazarus\" Dialog"

#: lazarusidestrconsts.lislazbuildwithstaticpackages
msgid "With packages"
msgstr "Mit Packages"

#: lazarusidestrconsts.lislcl
msgid "LCL"
msgstr "LCL"

#: lazarusidestrconsts.lislclunitpathmissing
msgid "LCL unit path missing"
msgstr "Fehlender LCL-Unit-Pfad"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL Widget Type"
msgstr "LCL-Schnittstelle"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Link zum Vorgänger hinzufügen"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Vom Vorläufer kopieren"

#: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo
msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s hat keinen gültigen LazDoc-Pfad.%sKann die FPDoc-Datei für %s nicht schreiben"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Einträge zu den vererbten verschieben"

#: lazarusidestrconsts.lisldnovalidlazdocpath
msgid "No valid LazDoc path"
msgstr "Kein gültiger LazDoc-Pfad"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Die Unit %s gehört zu keinem Package oder Projekt.%sBitte fügen Sie die Unit zu einem Package oder Projekt hinzu.%sKann die FPDoc-Datei nicht generieren."

#: lazarusidestrconsts.lisleaveemptyfo
msgid "Leave empty for default .po file"
msgstr "Für voreingestellte .po-Datei freilassen"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Links"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Linker Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz links vom Element verwendet."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Linke Verankerung"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontro,l an das die linke Seite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Linke Seiten"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Linker Abstand gleich"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Stufen"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM-Datei"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM-Datei ist defekt"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM ist ok"

#: lazarusidestrconsts.lislgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<Beschreibung>%sCopyright (C) <Jahr> <Names des Autors> <Kontakt>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin
#, fuzzy
#| msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus."
msgid "Library%sA Free Pascal library (.dll under Windows, .so under Linux, .dylib under MacOS X). The library source is automatically maintained by Lazarus."
msgstr "Bibliothek%sEine Free-Pascal-Bibliothek (.dll unter Windows, .so in Linux/BSD, .dylib bei MacOS X). Die Bibliotheks-Quelldatei wird automatisch von Lazarus gepflegt."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "Bibliothekspfad"

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Zeile:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Zeile/Länge"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Link:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Linker-Einstellungen"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Link-Ziel"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "Liste aller Case-Werte"

#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Laden von %s fehlgeschlagen"

#: lazarusidestrconsts.lislocals
msgid "Locals"
msgstr "Lokale Variablen"

#: lazarusidestrconsts.lislocalsdlgname
msgctxt "lazarusidestrconsts.lislocalsdlgname"
msgid "Name"
msgstr "Name"

#: lazarusidestrconsts.lislocalsdlgvalue
msgctxt "lazarusidestrconsts.lislocalsdlgvalue"
msgid "Value"
msgstr "Wert"

#: lazarusidestrconsts.lislogmessage
msgid "Log message"
msgstr "Protokoll"

#: lazarusidestrconsts.lislogo
msgid "Logo"
msgstr "Logo"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Zeichenkette in Kleinbuchstaben"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter"
msgstr "Kleinbuchstabige Zeichenkette als Parameter gegeben"

#: lazarusidestrconsts.lislrsincludefiles
msgid "lrs include files"
msgstr "lrs Include-Dateien"

#: lazarusidestrconsts.lismacpascal
msgid "Mac Pascal"
msgstr "Mac-Pascal"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Makro %s"

#: lazarusidestrconsts.lismacroname
msgid "Macro name"
msgstr "Makro-Name"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Daten eingeben"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "»Run«-Parameter angeben"

#: lazarusidestrconsts.lismacrovalue
msgid "Macro value"
msgstr "Makro-Wert"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main Unit has Application.CreateForm statements"
msgstr "Die Haupt-Unit enthält die Anweisung »Application.CreateForm«."

#: lazarusidestrconsts.lismainunithasapplicationtitlestatements
msgid "Main Unit has Application.Title statements"
msgstr "Die Haupt-Unit enthält die Anweisung »Application.Title«."

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main Unit has Uses Section containing all Units of project"
msgstr "Die Hauptunit enthält einen Uses-Abschnitt mit allen Units des Projekt"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main Unit is Pascal Source"
msgstr "Hauptunit ist ein Pascal-Quelltext"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Erzeuge ausführbare Datei"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make nicht gefunden"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Ressourcenstring erzeugen"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "An Ressourcenstring-Abschnitt anhängen"

#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Der Ressourcenstring %s%s%s ist bereits angelegt.%sBitte wählen Sie einen anderen Namen.%sDrücken Sie »Übergehen«, um ihn trotzdem zuzufügen."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Konvertierungseinstellungen"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Benutzerdefinierter Bezeichner"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Bezeichner"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Bezeichnerlänge:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Bezeichner-Präfix"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Alphabetisch einfügen"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Kontextsensitiv einfügen"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Ungültiger Ressourcenstring-Abschnitt"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Bitte wählen Sie einen Ressourcenstring aus der Liste."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Ressourcenstring bereits vorhanden"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Ressourcenstring-Abschnitt:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Quelltext-Vorschau"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Stringkonstanten im Quelltext"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Strings mit gleichen Werten:"

#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Max %d"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Speicherauszug"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Kompilieren abbrechen"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Über FPC"

#: lazarusidestrconsts.lismenuaddbpsource
msgid "Source breakpoint"
msgstr "Quelltext-Haltepunkt"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add breakpoint"
msgstr "Neuer Haltepunkt"

#: lazarusidestrconsts.lismenuaddcurunittopkg
msgid "Add active unit to a package"
msgstr "Aktuelle Unit in ein Package aufnehmen"

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add jump point to history"
msgstr "Sprungmarke speichern"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add editor file to Project"
msgstr "Datei im Editor ins Projekt aufnehmen"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add watch ..."
msgstr "Überwachung hinzufügen..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in selection"
msgstr "Zeilen in der Auswahl umbrechen"

#: lazarusidestrconsts.lismenubuild
msgctxt "lazarusidestrconsts.lismenubuild"
msgid "Build"
msgstr "Neu kompilieren"

#: lazarusidestrconsts.lismenubuildall
msgid "Build all"
msgstr "Alles neu kompilieren"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Datei neu kompilieren"

#: lazarusidestrconsts.lismenubuildlazarus
#| msgid "Build Lazarus"
msgid "Build Lazarus with current profile"
msgstr "Lazarus mit aktuellem Profil neu kompilieren"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with profile: %s"
msgstr "Kompiliere Lazarus mit Profil: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM file in editor"
msgstr "LFM-Datei im Editor überprüfen"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean directory ..."
msgstr "Verzeichnis säubern ..."

#: lazarusidestrconsts.lismenuclose
msgctxt "lazarusidestrconsts.lismenuclose"
msgid "Close"
msgstr "Schließen"

#: lazarusidestrconsts.lismenucloseall
#| msgid "Close all editor files"
msgid "Close a&ll editor files"
msgstr "Alle Editorfenster schließen"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Projekt schließen"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools defines editor ..."
msgstr "Editor für CodeTools-Eigenschaften ..."

#: lazarusidestrconsts.lismenucollectpofil
msgid "Collect .po files"
msgstr ".PO-Dateien sammeln"

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment selection"
msgstr "Auswahl kommentieren"

#: lazarusidestrconsts.lismenucompileroptions
msgid "Compiler Options ..."
msgstr "Compilereinstellungen ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Quelltext vervollständigen"

#: lazarusidestrconsts.lismenuconditionalselection
msgid "Insert $IFDEF..."
msgstr "$IFDEF einfügen"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Kompilieren+Starten der Datei einrichten..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure custom components ..."
msgstr "Externe Komponenten einrichten ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure external tools ..."
msgstr "Externe Werkzeuge einrichten ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "»Lazarus kompilieren« einrichten ..."

#: lazarusidestrconsts.lismenuconfigurehelp
msgid "Configure Help ..."
msgstr "Hilfefunktion einrichten ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Kontextsensitive Hilfe"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi package to Lazarus package ..."
msgstr "Delphi- in Lazarus-Package umwandeln ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi project to Lazarus project ..."
msgstr "Delphi- in Lazarus-Projekt umwandeln ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi unit to Lazarus unit ..."
msgstr "Delphi- in Lazarus-Unit umwandeln ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert DFM file to LFM ..."
msgid "Convert binary DFM file to text LFM and check syntax ..."
msgstr "DFM- in LFM-Datei umwandeln ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert encoding of projects/packages ..."
msgstr "Kodierungen von Projekten/Packages konvertieren ..."

#: lazarusidestrconsts.lismenucopy
msgctxt "lazarusidestrconsts.lismenucopy"
msgid "Copy"
msgstr "Kopieren"

#: lazarusidestrconsts.lismenucreatefpdocfiles
msgid "Create FPDoc files"
msgstr "FPDoc-Dateien erzeugen"

#: lazarusidestrconsts.lismenucreatepofile
msgid "Create .po files"
msgstr "Erzeuge .po-Dateien"

#: lazarusidestrconsts.lismenucut
msgctxt "lazarusidestrconsts.lismenucut"
msgid "Cut"
msgstr "Ausschneiden"

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug windows"
msgstr "Debuggerfenster"

#: lazarusidestrconsts.lismenudiff
msgctxt "lazarusidestrconsts.lismenudiff"
msgid "Diff"
msgstr "Dateivergleich"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "B&earbeiten"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Vorlagen ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Kontextsensitive Hilfe bearbeiten"

#: lazarusidestrconsts.lismenueditinstallpkgs
#, fuzzy
#| msgid "Configure installed packages ..."
msgid "Install/Uninstall packages ..."
msgstr "Installierte Packages einrichten ..."

#: lazarusidestrconsts.lismenueditor
msgid "Menu Editor..."
msgstr "Menü-Editor..."

#: lazarusidestrconsts.lismenueditorcancel
msgctxt "lazarusidestrconsts.lismenueditorcancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.lismenueditorcreatesubmenu
msgid "Create Submenu"
msgstr "Erzeuge Untermenü"

#: lazarusidestrconsts.lismenueditordeletefromtemplate
msgid "Delete From Template..."
msgstr "Aus der Vorlage löschen..."

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "Delete Item"
msgstr "Eintrag löschen"

#: lazarusidestrconsts.lismenueditorhandleonclickevent
msgid "Handle OnClick Event"
msgstr "Ereignis OnClick behandeln"

#: lazarusidestrconsts.lismenueditorinsertfromtemplate
msgid "Insert From Template..."
msgstr "Aus Vorlage einfügen"

#: lazarusidestrconsts.lismenueditorinsertnewitemafter
msgid "Insert New Item (after)"
msgstr "Neuen Eintrag einfügen (dahinter)"

#: lazarusidestrconsts.lismenueditorinsertnewitembefore
msgid "Insert New Item (before)"
msgstr "Neuen Eintrag einfügen (davor)"

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menüeditor"

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Nach unten (oder rechts) bewegen"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Nach oben (oder links) bewegen"

#: lazarusidestrconsts.lismenueditornewtemplatedescription
msgid "New Template Description..."
msgstr "Neue Vorlagenbeschreibung ..."

#: lazarusidestrconsts.lismenueditorsaveastemplate
msgid "Save As Template..."
msgstr "Als Vorlage speichern ..."

#: lazarusidestrconsts.lismenueditorselectmenu
msgid "Select Menu:"
msgstr "Menü auswählen:"

#: lazarusidestrconsts.lismenueditorselecttemplate
msgid "Select Template:"
msgstr "Vorlage auswählen:"

#: lazarusidestrconsts.lismenueditortemplatepreview
msgid "Template Preview"
msgstr "Vorlagenvorschau"

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose selection ..."
msgstr "Auswahl einschließen ..."

#: lazarusidestrconsts.lismenuenvironent
msgid "E&nvironment"
msgstr "Ei&nstellungen"

#: lazarusidestrconsts.lismenuevaluate
msgid "Evaluate/Modify ..."
msgstr "Prüfen/Ändern ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract procedure ..."
msgstr "Prozedur extrahieren ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Datei"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Suchen"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Suchen ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find other end of code block"
msgstr "Anderes Ende des Quelltextblocks suchen"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find code block start"
msgstr "Zu Quelltextblockanfang gehen"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at cursor"
msgstr "Deklaration unter Cursor suchen"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Bezeichnerreferenzen suchen ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in files ..."
msgstr "&In Dateien suchen ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "&Weitersuchen"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "&Rückwärts suchen"

#: lazarusidestrconsts.lismenufpdoceditor
msgctxt "lazarusidestrconsts.lismenufpdoceditor"
msgid "FPDoc Editor"
msgstr "FPDoc-Editor"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Einstellungen ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto include directive"
msgstr "Zu Include-Anweisung springen"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto line ..."
msgstr "Zu Zeile springen ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess misplaced IFDEF/ENDIF"
msgstr "Offene IFDEF/ENDIF erraten"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess unclosed block"
msgstr "Offene Quelltextblöcke erraten"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Hilfe"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE internals"
msgstr "IDE-Interna"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Inkrementelle Suche"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent selection"
msgstr "Block einrücken"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog entry"
msgstr "Eintrag für Änderungsprotokoll"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map"
msgstr "Aus der Zeichentabelle einfügen"

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "CVS keyword"
msgstr "CVS-Schlüsselwort"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current date and time"
msgstr "Aktuelles Datum und Uhrzeit"

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "General"
msgstr "Allgemein"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL notice"
msgstr "GPL-Hinweis"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL notice"
msgstr "LGPL-Hinweis"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL notice"
msgstr "Angepaßter LGPL-Hinweis"

#: lazarusidestrconsts.lismenuinserttext
msgid "Insert text"
msgstr "Text einfügen"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current username"
msgstr "Aktueller Benutzername"

#: lazarusidestrconsts.lismenuinspect
msgid "Inspect ..."
msgstr "Inspizieren ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump back"
msgstr "Zurückspringen"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump forward"
msgstr "Vorwärtsspringen"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Springe zu"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to next bookmark"
msgstr "Springe zum nächsten Lesezeichen"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to next error"
msgstr "Zum nächsten Fehler springen"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to previous bookmark"
msgstr "Springe zum vorherigen Lesezeichen"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to previous error"
msgstr "Zum vorherigen Fehler springen"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase selection"
msgstr "Auswahl kleinschreiben"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Ressourcenstring erzeugen ..."

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Neues Formular"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Neu ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New package ..."
msgstr "Neues Package..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Neues Projekt ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from file ..."
msgstr "Neues Projekt aus Datei ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Neue Unit"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Online-Hilfe"

#: lazarusidestrconsts.lismenuopen
#| msgid "Open ..."
msgid "&Open ..."
msgstr "Öffnen ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open filename at cursor"
msgstr "Datei unter Cursor öffnen"

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open loaded package ..."
msgstr "Geladenes Package öffnen ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open package file (.lpk) ..."
msgstr "Package-Datei (.lpk) öffnen ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open package of current unit"
msgstr "Package der aktuellen Unit öffnen"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Projekt öffnen ..."

#: lazarusidestrconsts.lismenuopenrecent
#| msgid "Open Recent ..."
msgid "Open &Recent ..."
msgstr "Wieder öffnen ..."

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open recent package ..."
msgstr "Letztes Package wieder öffnen ..."

#: lazarusidestrconsts.lismenuopenrecentproject
msgid "Open Recent Project ..."
msgstr "Letzte Projekte ..."

#: lazarusidestrconsts.lismenupackage
msgid "&Package"
msgstr "&Package"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph ..."
msgstr "Package-Graph ..."

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package links ..."
msgstr "Package-Links ..."

#: lazarusidestrconsts.lismenupaste
msgctxt "lazarusidestrconsts.lismenupaste"
msgid "Paste"
msgstr "Einfügen"

#: lazarusidestrconsts.lismenupause
msgctxt "lazarusidestrconsts.lismenupause"
msgid "Pause"
msgstr "Pause"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Prozedur-Liste ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projektinspektor ..."

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projekteinstellungen ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "Run"
msgstr "Start"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Projekt veröffentlichen ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick compile"
msgstr "Schnelles Kompilieren"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick syntax check"
msgstr "Schnelle Syntaxprüfung"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Schnelle Syntaxprüfung OK"

#: lazarusidestrconsts.lismenuquit
#| msgid "Quit"
msgid "&Quit"
msgstr "&Beenden"

#: lazarusidestrconsts.lismenuredo
msgctxt "lazarusidestrconsts.lismenuredo"
msgid "Redo"
msgstr "Wiederholen"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Aus Projekt entfernen ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Bezeichner umbenennen ..."

#: lazarusidestrconsts.lismenureplace
msgctxt "lazarusidestrconsts.lismenureplace"
msgid "Replace"
msgstr "Ersetzen"

#: lazarusidestrconsts.lismenureplace2
msgid "&Replace ..."
msgstr "E&rsetzen ..."

#: lazarusidestrconsts.lismenureportingbug
msgid "Reporting a bug..."
msgstr "Fehler melden ..."

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC source directory"
msgstr "FPC-Quelltextverzeichnis neu einlesen"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset debugger"
msgstr "Debugger zurücksetzen"

#: lazarusidestrconsts.lismenurestart
msgid "Restart"
msgstr "Neustart"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Wiederherstellen"

#: lazarusidestrconsts.lismenurun
msgid "&Run"
msgstr "Sta&rt"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Datei ausführen"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run Parameters ..."
msgstr "Startparameter ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Run to cursor"
msgstr "Start bis Cursor"

#: lazarusidestrconsts.lismenusave
#| msgid "Save"
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Speichern"

#: lazarusidestrconsts.lismenusaveall
msgid "Save All"
msgstr "Alles speichern"

#: lazarusidestrconsts.lismenusaveas
#| msgid "Save As ..."
msgid "Save &As ..."
msgstr "Speichern unter ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Projekt speichern"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Projekt speichern unter ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Suchen"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Auswählen"

#: lazarusidestrconsts.lismenuselectall
msgid "Select all"
msgstr "Alles auswählen"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select code block"
msgstr "Quelltextblock auswählen"

#: lazarusidestrconsts.lismenuselectline
msgid "Select line"
msgstr "Zeile auswählen"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select paragraph"
msgstr "Absatz auswählen"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to brace"
msgstr "Bis zur Klammer"

#: lazarusidestrconsts.lismenuselectword
msgid "Select word"
msgstr "Wort auswählen"

#: lazarusidestrconsts.lismenusetfreebookmark
msgid "Set a free bookmark"
msgstr "Freies Lesezeichen setzen"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "Show execution point"
msgstr "Ausführungspunkt anzeigen"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort selection ..."
msgstr "Auswahl sortieren ..."

#: lazarusidestrconsts.lismenustepinto
msgid "Step into"
msgstr "Einen Schritt hinein"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step into (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step into instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepout
msgid "Step out"
msgstr "Hinausgehen"

#: lazarusidestrconsts.lismenustepover
msgid "Step over"
msgstr "Einen Schritt weiter"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step over (Context)"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step over instruction"
msgstr ""

#: lazarusidestrconsts.lismenustop
msgctxt "lazarusidestrconsts.lismenustop"
msgid "Stop"
msgstr "Halt"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to spaces in selection"
msgstr "Tabulatoren in Auswahl in Leerzeichen umwandeln"

#: lazarusidestrconsts.lismenutemplateabout
msgid "About"
msgstr "Über"

#: lazarusidestrconsts.lismenutemplateclose
msgctxt "lazarusidestrconsts.lismenutemplateclose"
msgid "Close"
msgstr "Schließen"

#: lazarusidestrconsts.lismenutemplatecontents
msgid "Contents"
msgstr "Inhalt"

#: lazarusidestrconsts.lismenutemplatecopy
msgctxt "lazarusidestrconsts.lismenutemplatecopy"
msgid "Copy"
msgstr "Kopieren"

#: lazarusidestrconsts.lismenutemplatecut
msgctxt "lazarusidestrconsts.lismenutemplatecut"
msgid "Cut"
msgstr "Ausschneiden"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu
msgid "Standard Edit Menu"
msgstr "Standard-Editormenü"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu
msgid "Standard File Menu"
msgstr "Standard-Dateimenü"

#: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu
msgid "Standard Help Menu"
msgstr "Standard-Hilfemenü"

#: lazarusidestrconsts.lismenutemplateedit
msgctxt "lazarusidestrconsts.lismenutemplateedit"
msgid "Edit"
msgstr "Bearbeiten"

#: lazarusidestrconsts.lismenutemplateexit
msgctxt "lazarusidestrconsts.lismenutemplateexit"
msgid "Exit"
msgstr "Beenden"

#: lazarusidestrconsts.lismenutemplatefile
msgctxt "lazarusidestrconsts.lismenutemplatefile"
msgid "File"
msgstr "Datei"

#: lazarusidestrconsts.lismenutemplatefind
msgctxt "lazarusidestrconsts.lismenutemplatefind"
msgid "Find"
msgstr "Suchen"

#: lazarusidestrconsts.lismenutemplatefindnext
msgid "Find Next"
msgstr "Nächsten suchen"

#: lazarusidestrconsts.lismenutemplatehelp
msgctxt "lazarusidestrconsts.lismenutemplatehelp"
msgid "Help"
msgstr "Hilfe"

#: lazarusidestrconsts.lismenutemplatenew
msgid "New"
msgstr "Neu"

#: lazarusidestrconsts.lismenutemplateopen
msgctxt "lazarusidestrconsts.lismenutemplateopen"
msgid "Open"
msgstr "Öffnen"

#: lazarusidestrconsts.lismenutemplateopenrecent
msgctxt "lazarusidestrconsts.lismenutemplateopenrecent"
msgid "Open Recent"
msgstr "Wieder öffnen"

#: lazarusidestrconsts.lismenutemplatepaste
msgctxt "lazarusidestrconsts.lismenutemplatepaste"
msgid "Paste"
msgstr "Einfügen"

#: lazarusidestrconsts.lismenutemplateredo
msgctxt "lazarusidestrconsts.lismenutemplateredo"
msgid "Redo"
msgstr "Wiederholen"

#: lazarusidestrconsts.lismenutemplatesave
msgctxt "lazarusidestrconsts.lismenutemplatesave"
msgid "Save"
msgstr "Speichern"

#: lazarusidestrconsts.lismenutemplatesaveas
msgid "Save As"
msgstr "Speichern unter ..."

#: lazarusidestrconsts.lismenutemplatetutorial
msgid "Tutorial"
msgstr "Einführung"

#: lazarusidestrconsts.lismenutemplateundo
msgctxt "lazarusidestrconsts.lismenutemplateundo"
msgid "Undo"
msgstr "Zurücknehmen"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle comment"
msgstr "Kommentar umschalten"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Werkzeuge"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment selection"
msgstr "Auswahl entkommentieren"

#: lazarusidestrconsts.lismenuundo
msgctxt "lazarusidestrconsts.lismenuundo"
msgid "Undo"
msgstr "Rückgängig"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent selection"
msgstr "Auswahl ausrücken"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase selection"
msgstr "Auswahl großschreiben"

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Ansicht"

#: lazarusidestrconsts.lismenuviewanchoreditor
#| msgid "View Anchor Editor"
msgid "Anchor Editor"
msgstr "Ankereditor anzeigen"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Haltepunkte"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Aufrufstack"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgid "Code Browser"
msgstr "Code-Browser"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "CodeExplorer ..."

#: lazarusidestrconsts.lismenuviewcomponentpalette
#| msgid "View Component Palette"
msgid "Component Palette"
msgstr "Komponentenpalette anzeigen"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Komponenten"

#: lazarusidestrconsts.lismenuviewdebugevents
#, fuzzy
#| msgid "Debug events"
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Debug-Ereignisse"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug output"
msgstr "Debuggerausgaben"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms..."
msgstr "Formulare ..."

#: lazarusidestrconsts.lismenuviewidespeedbuttons
#| msgid "View IDE speed buttons"
msgctxt "lazarusidestrconsts.lismenuviewidespeedbuttons"
msgid "IDE speed buttons"
msgstr "Speedbuttons der IDE anzeigen"

#: lazarusidestrconsts.lismenuviewjumphistory
#, fuzzy
#| msgid "Jump-History ..."
msgid "Jump History ..."
msgstr "Sprungliste anzeigen ..."

#: lazarusidestrconsts.lismenuviewlocalvariables
msgid "Local Variables"
msgstr "Lokale Variablen"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Nachrichten ..."

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Objektinspektor"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Register"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Browser für bedingte Eigenschaften"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Suchergebnisse"

#: lazarusidestrconsts.lismenuviewsource
msgid "&View Source"
msgstr "&Quelltext anzeigen"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Quelltexteditor"

#: lazarusidestrconsts.lismenuviewtodolist
msgctxt "lazarusidestrconsts.lismenuviewtodolist"
msgid "ToDo List"
msgstr "Liste des zu Erledigenden"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle form/unit view"
msgstr "Formular-/Unit-Ansicht umschalten"

#: lazarusidestrconsts.lismenuviewunitdependencies
#| msgid "View Unit Dependencies"
msgid "Unit Dependencies"
msgstr "Unit-Abhängigkeiten anzeigen"

#: lazarusidestrconsts.lismenuviewunitinfo
#| msgid "View Unit Information"
msgid "Unit Information"
msgstr "Unit-Informationen anzeigen"

#: lazarusidestrconsts.lismenuviewunits
msgid "Units..."
msgstr "Units ..."

#: lazarusidestrconsts.lismenuviewwatches
msgid "Watches"
msgstr "Überwachte Ausdrücke"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Fenster"

#: lazarusidestrconsts.lismessagecontainsnofilepositioninformation
msgid "Message contains no file position information:%s%s"
msgstr ""

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Nachrichten-Editor"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Methodenklasse nicht gefunden"

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Fehlende Events"

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Fehlende Bezeichner"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Fehlende Packages"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Ihre Auswahl ist:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Auskommentieren"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Nur für Delphi"

#: lazarusidestrconsts.lismissingunitsinfo1
#, fuzzy
#| msgid "1) Comment out the missing units (ignore them)."
msgid "1) Comment out the selected units."
msgstr "1) Alle fehlenden Units auskommentieren (übergehen)."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Units nur bei Delphi einbinden"

#: lazarusidestrconsts.lismissingunitsinfo2
#, fuzzy
#| msgid "2) Select a unit path which will be added to project settings."
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Unit-Pfad auswählen, der zu den Projekteinstellungen hunzugefügt wird."

#: lazarusidestrconsts.lismissingunitsinfo3
#, fuzzy
#| msgid "3) Abort now, fix the unit path or install packages and try again."
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Jetzt abbrechen, die Unit-Pfade korrigieren oder Packages installieren und noch einmal probieren."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Unit-Pfade durchsuchen"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid "<description>%sCopyright (C) <year> <name of author> <contact>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."
msgstr "<Beschreibung>%sCopyright (C) <Jahr> <Name des Autors> <Kontakt>%sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA."

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "Ändern"

#: lazarusidestrconsts.lismore
msgid "More"
msgstr "Weiter"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Bewege \"%s\" eine Position nach unten"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Bewege \"%s\" eine Position nach oben"

#: lazarusidestrconsts.lismovepage
msgid "Move Page ..."
msgstr "Seite verschieben ..."

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Meldungen in eine Datei (*.txt) schreiben"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Namenskonflikt"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Name der neuen Prozedur"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nie"

#: lazarusidestrconsts.lisnew
msgid "new"
msgstr "neu"

#: lazarusidestrconsts.lisnewancestors
msgid "New Ancestors"
msgstr "Neue Vorfahren"

#: lazarusidestrconsts.lisnewbuildmode
msgid "New build mode"
msgstr "Neuer Kompiliermodus"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Neue Klasse"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Neue Konsolenanwendung"

#: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained
#, fuzzy
#| msgid "Create a new cgi application.%sThe program file is maintained by Lazarus."
msgid "Create a new CGI application.%sThe application source is maintained by Lazarus."
msgstr "Legt eine neuen CGI-Anwendung an.%sDie Programmdatei wird von Lazarus betreut."

#: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram
msgid "Create a new program."
msgstr "Erzeugt ein neues Programm."

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Erzeugt eine neue Editordatei.%sWählen Sie den Typ."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Erzeugt eine neue leere Textdatei."

#: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication
#, fuzzy
#| msgid "Create a new graphical application.%sThe program file is maintained by Lazarus."
msgid "Create a new graphical application.%sThe application source is maintained by Lazarus."
msgstr "Erzeugt eine neue grafische Applikation.%sDas Programm wird von Lazarus gewartet."

#: lazarusidestrconsts.lisnewdlgcreateanewpascalunit
msgid "Create a new pascal unit."
msgstr "Erzeugt eine neue Pascal-Unit"

#: lazarusidestrconsts.lisnewdlgcreateanewprogram
#| msgid "Create a new program.%sThe program file is maintained by Lazarus."
msgid "Create a new program.%sThe program source is maintained by Lazarus."
msgstr "Erzeugt eine neues Programm.%sDer Programmquellcode wird von Lazarus gewartet."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Erzeugt neues Projekt.%sWählen Sie einen Typ."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Erzeugt ein neues Standard-Packages.%sEin Package ist eine Sammlung von Units und Komponenten."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Erzeugt eine neue Unit mit einem Datenmodul."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
#| msgid "Create a new unit with a frame"
msgid "Create a new unit with a frame."
msgstr "Erzeugt eine neue Unit mit einem Frame"

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Erzeugt eine neue Unit mit einem LCL-Formular."

#: lazarusidestrconsts.lisnewdlginheritanexistingcomponent
msgid "Inherit from an existing component."
msgstr "Von einer vorhandenen Komponente ableiten."

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Keine Einträge gewählt"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Bitte wählen Sie zuerst einen Eintrag"

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Neue Kodierung:"

#: lazarusidestrconsts.lisnewgroupasetofmodes
msgid "New group - a set of modes"
msgstr "Neue Gruppe - eine Menge von Modi"

#: lazarusidestrconsts.lisnewproject
#| msgid "%s - (new project)"
msgid "(new project)"
msgstr "(neues Projekt)"

#: lazarusidestrconsts.lisnewsetting
msgid "New setting"
msgstr "Neue Einstellung"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections:"
msgstr "Neue Units werden zum Uses-Abschnitt hinzugefügt:"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Nein"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Keine Backups"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Es sind keine Profile zum Erstellen ausgewählt."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Keine Änderung"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Kein Code ausgewählt"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Keine abgeleiteten Compilereinstellungen"

#: lazarusidestrconsts.lisnoerrors
msgid "No errors"
msgstr "Keine Fehler"

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "keine Hinweise"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Kein IDE-Fenster ausgewählt"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Keine LFM Datei"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Kein Makro ausgewählt"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "unbenannt"

#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%skeine"

#: lazarusidestrconsts.lisnone2
msgid "none"
msgstr "keine"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "kein Knoten gewählt"

#: lazarusidestrconsts.lisnopascalfile
msgid "No pascal file"
msgstr "Keine Pascal Datei"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file %s%s%s found."
msgstr "Programmdatei %s%s%s nicht gefunden."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Kein ResourceString-Abschnitt gefunden"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalerweise ist der Filter ein regulärer Ausdruck. Bei *Einfacher Syntax* gilt ein Punkt als normales Zeichen, ein * steht für eine beliebige Zeichenkette, ein ? für ein beliebiges Zeichen, und ein Komma und Semikolon als Trenner zwischen Alternativen. Beispiel: Einfache Syntax *.pas;*.pp bedeutet ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Keine Stringkonstante gefunden"

#: lazarusidestrconsts.lisnotadelphiproject
msgid "Not a Delphi project"
msgstr "Kein Delphi-Projekt"

#: lazarusidestrconsts.lisnotadelphiunit
msgid "Not a Delphi unit"
msgstr "Keine Delphi-Unit"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr ""

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid pascal identifier"
msgstr "Kein gültiger Pascal-Bezeichner"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "Hinweis: Kann definiertes Template für Free Pascal Quellenverzeichnis nicht finden"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "Hinweis: Konnte das Definitons-Template für Lazarus-Quellen nicht erzeugen"

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Nicht implementiert"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Noch nicht implementiert:%s%s"

#: lazarusidestrconsts.lisnotimplementedyet2
msgid "Not implemented yet."
msgstr "Noch nicht implementiert."

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Nicht jetzt"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Erzeuge"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Erzeuge neues Projekt"

#: lazarusidestrconsts.lisnpselectaprojecttype
msgid "Select a project type"
msgstr "Projekttyp auswählen"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Zahl der umzuwandelnden Dateien: %s"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - Voreinst."

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "Objektpfad"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Zum Favoriten-Reiter des Objektinspektors umschalten"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestabafterasking
msgid "Switch to Object Inspector Favorites tab after asking for component name"
msgstr "Nach der Abfrage des Komponentennamens zum Favoriten-Reiter des Objektinspektors umschalten"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Aus)"

#: lazarusidestrconsts.lisoifaddtofavouriteproperties
msgid "Add to favourite properties"
msgstr "Zu den bevorzugten Eigenschaften hinzufügen"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty
msgid "Choose a base class for the favourite property %s%s%s."
msgstr "Wählen Sie eine Basisklasse für den Favoriten %s%s%s."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class %s%s%s not found."
msgstr "Klasse %s%s%s nicht gefunden."

#: lazarusidestrconsts.lisoifremovefromfavouriteproperties
msgid "Remove from favourite properties"
msgstr "Von den bevorzugten Eigenschaften entfernen"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "dynamische automatische Installation"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "statische automatische Installation"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Beschreibung:"

#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription:  %s"
msgstr "%sBeschreibung:  %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Dateiname: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "dynamisch installiert"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "statisch installiert"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "fehlt"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "geändert"

#: lazarusidestrconsts.lisoipnopackageselected
msgid "No package selected"
msgstr "Kein Package gewählt"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open loaded package"
msgstr "Geladenes Package öffnen"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Package-Name"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Bitte wählen Sie ein Package aus"

#: lazarusidestrconsts.lisoippleaseselectapackagetoopen
msgid "Please select a package to open"
msgstr "Bitte wählen Sie ein Package zum Öffnen aus"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "schreibgeschützt"

#: lazarusidestrconsts.lisoipstate
msgid "State"
msgstr "Status"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed, but the lpk file was not found"
msgstr "%sDas Package ist installiert, aber die .lpk-Datei wurde nicht gefunden"

#: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated
msgid "%sThis package was automatically created"
msgstr "%sDieses Package wurde automatisch erzeugt"

#: lazarusidestrconsts.lisok
#| msgid "&Ok"
msgid "&OK"
msgstr "&OK"

#: lazarusidestrconsts.lisold
msgid "old"
msgstr "alt"

#: lazarusidestrconsts.lisoldancestors
msgid "Old Ancestors"
msgstr "Alte Vorfahren"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Alte Klasse"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (An)"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Beim Zeilenumbruch (z.B. Return- oder Enter-Taste)"

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Suche nur nach ganzen Worten"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Beim Einfügen aus der Zwischenablage"

#: lazarusidestrconsts.lisopen
msgid "Open ..."
msgstr ""

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Als XML-Datei öffnen"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Geöffnete Unit in Designer laden"

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Vorhandene Datei öffnen"

#: lazarusidestrconsts.lisopenfile
msgid "Open file"
msgstr "Datei öffnen"

#: lazarusidestrconsts.lisopenfile2
msgid "Open File ..."
msgstr "Datei öffnen ..."

#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Öffne %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Package öffnen?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Package %s öffnen"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Package-Datei wählen"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Projekt öffnen?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Projekt öffnen"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Projekt erneut öffnen"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Projektdatei öffnen"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Offener symbolischer Link"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Offenes Ziel"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Datei als normalen Quelltext öffnen"

#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Package %s öffnen?"

#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Projekt %s öffnen?"

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "oder"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Sprache überschreiben. Beispielsweise --language=de. Für die möglichen Werte siehe die Dateien im Verzeichnis »languages«."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%süberschreibt den voreingestellten Compiler, z.B. ppc386, ppcx64, ppcppc etc. Die Voreinstellung ist in environmentoptions.xm abgelegt"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project build mode."
msgstr "%hebt den Projekt-Erstellmodus auf"

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%süberschreibt die Projekt-CPU, z.B. i386, x86_64, powerpc, powerpc_64 usw. Voreinstellung: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%überschreibt das Betriebssystem des Projekts, z.B. win32, linux. Voreinstellung: %s"

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sÜberschreibt das Widget-Set des Projekts. Z.B. GTK, GTK2, Qt, Win32, Carbon. Voreinstellung: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Datei überschreiben?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Datei auf Datenträger überschreiben"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "»Owner« wird bereits vom TReader/TWriter verwendet. Bitte wählen sie einen anderen Namen."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Package"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "Package %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package Info"
msgstr "Package-Info"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Name des Packages beginnt mit ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Name des Packages enthält ..."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Package benötigt eine Installation"

#: lazarusidestrconsts.lispackagestoinstallintheide
msgid "Packages to install in the IDE"
msgstr "Packages für die Installation in der IDE"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "Package-Unit"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ""

#: lazarusidestrconsts.lispascalsourcefile
msgid "Pascal source file"
msgstr "Pascal-Quelldatei"

#: lazarusidestrconsts.lispascalunit
msgid "Pascal unit"
msgstr "Pascal-Unit"

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Laufzähler"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Zwischenablage einfügen"

#: lazarusidestrconsts.lispastetextfromclipboard
msgid "Paste text from clipboard"
msgstr "Text aus der Zwischenablage einfügen"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Pfad"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Durchsuchen"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down"
msgstr "Pfad nach unten bewegen"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up"
msgstr "Pfad nach oben bewegen"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Pfad-Templates"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Suchpfade:"

#: lazarusidestrconsts.lispatheditselectdirectory
msgid "Select directory"
msgstr "Verzeichnis auswählen"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Pfad zum Make-Programm"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Pfad zur fehlgeschlagenen Instanz:"

#: lazarusidestrconsts.lispckeditaddanitem
msgid "Add an item"
msgstr "Eintrag hinzufügen"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to project"
msgstr "Zum Projekt hinzufügen"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Änderungen übernehmen"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "%sRegister%s-Prozedur dieser Unit aufrufen"

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Standard/Bevorzugter Dateiname dieser Abhängigkeit löschen"

#: lazarusidestrconsts.lispckeditcompile
msgctxt "lazarusidestrconsts.lispckeditcompile"
msgid "Compile"
msgstr "Kompilieren"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Alles kompilieren?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Package kompilieren"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Compilereinstellungen für Package %s"

#: lazarusidestrconsts.lispckeditcompopts
msgctxt "lazarusidestrconsts.lispckeditcompopts"
msgid "Compiler Options"
msgstr "Compilereinstellungen"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Makedatei erzeugen"

#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, Standard: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Abhängigkeitseigenschaften"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit General Options"
msgstr "Allgemeine Einstellungen"

#: lazarusidestrconsts.lispckediteditoptionstocompilepackage
msgid "Edit Options to compile package"
msgstr "Package-Kompilierungseinstellungen"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Dateieigenschaften"

#: lazarusidestrconsts.lispckeditgeneraloptions
msgid "General Options"
msgstr "Package-Einstellungen"

#: lazarusidestrconsts.lispckedithelp
msgctxt "lazarusidestrconsts.lispckedithelp"
msgid "Help"
msgstr "Hilfe"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installieren"

#: lazarusidestrconsts.lispckeditinstallpackageintheide
msgid "Install package in the IDE"
msgstr "Installiere Packages in der IDE"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Ungültige Maximalversion"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Ungültige Minimalvesion"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maximalversion:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimalversion:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Geändert: %s"

#: lazarusidestrconsts.lispckeditmore
msgid "More ..."
msgstr "Mehr ..."

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Abhängigkeit nach unten bewegen"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Abhängigkeit nach oben bewegen"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Package %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package %s%s%s has changed.%sSave package?"
msgstr "Package %s%s%s wurde geändert. %sPackage speichern?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "Package %s nicht gesichert"

#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Seite: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Wiederhinzufügen der Abhängigkeit"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Wiederhinzufügen der Datei"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Schreibgeschützt: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile all required"
msgstr "Alles Benötigte neu kompilieren"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile clean"
msgstr "Sauber rekompilieren"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Rekompiliere dieses und alle benötigten Packages"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Registrierte Plugins"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Registriere Unit"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Entferne Abhängigkeit"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Abhängigkeit entfernen?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency %s%s%s%sfrom package %s%s%s?"
msgstr "Abhängigkeit %s%s%s%saus dem package %s%s%s entfernen?"

#: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile
msgid "Removed Files (these entries are not saved to the lpk file)"
msgstr "Entfernte Dateien (diese Einträge werden nicht in die lpk-Datei gesichert)"

#: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved
msgid "Removed required packages (these entries are not saved to the lpk file)"
msgstr "Benötigtes Package entfernt (diese Einträge werden nicht in die lpk-Datei gesichert)"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Datei entfernen"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Datei entfernen?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file %s%s%s%sfrom package %s%s%s?"
msgstr "Datei %s%s%s%saus dem Package %s%s%s entfernen?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Gewählten Eintrag entfernen"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Benötigte Packages"

#: lazarusidestrconsts.lispckeditsavechanges
msgid "Save Changes?"
msgstr "Änderungen speichern"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save package"
msgstr "Package speichern"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Den Dateinamen als Standard speichern für diese Abhängigkeit"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Den Dateiname als Vorgabe für diese Abhängigkeit speichern"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Die maximale Version %s%s%s ist keine gültige Package-Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Die minimale Version %s%s%s ist keine gültige Package-Versionsangabe.%s(Ein gutes Beispiel wäre 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Deinstallieren"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Package-Quelltext anzeigen"

#: lazarusidestrconsts.lispckexplautocreated
msgid "AutoCreated"
msgstr "Automatisch erzeugt"

#: lazarusidestrconsts.lispckexplinstalled
msgid "Installed"
msgstr "Installiert"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installieren beim nächsten Start"

#: lazarusidestrconsts.lispckexplisrequiredby
msgid "Selected package is required by:"
msgstr "Das gewählte Package wird benötigt von:"

#: lazarusidestrconsts.lispckexplloadedpackages
msgid "Loaded Packages:"
msgstr "Geladene Packages:"

#: lazarusidestrconsts.lispckexplpackagenotfound
msgid "Package %s not found"
msgstr "Package %s nicht gefunden"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sZustand: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start"
msgstr "Beim nächsten Start entfernen"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Neue Einstellungen für abhängige Packages und Projekte"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Neue Pfade für abhängige Packages und Projekte"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author:"
msgstr "Autor:"

#: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild
msgid "Automatically increment version on build"
msgstr "Versionsnummer beim Kompilieren automatisch erhöhen"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Bei Bedarf automatisch neu kompilieren"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatisch kompilieren wenn alles kompiliert wird"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Benutzerdefiniert"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description/Abstract"
msgstr "Beschreibung/Zusammenfassung"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and Runtime"
msgstr "Entwicklungs- und Laufzeit"

#: lazarusidestrconsts.lispckoptsdesigntimeonly
msgid "Designtime only"
msgstr "Nur zur Entwicklungszeit"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "IDE-Integration"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Ungültiger Package-Typ"

#: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation
msgctxt "lazarusidestrconsts.lispckoptslazdoclazarusdocumentation"
msgid "FPDoc files path"
msgstr "FPDoc-Dateipfad"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Bibliothek"

#: lazarusidestrconsts.lispckoptslicense
msgid "License:"
msgstr "Lizenz:"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Haupt"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Manuelle Kompilierung (nie automatisch)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Unter"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objekt"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Package-Einstellungen"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "PackageType"
msgstr "Package-Typ"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Stellt zur Verfügung"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Release"

#: lazarusidestrconsts.lispckoptsruntimeonly
msgid "Runtime only"
msgstr "Nur zu Laufzeit"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages."
msgstr "Das Package %s%s%s besitzt die Kennung für automatische Installation.%sDas bedeutet, es wird in die IDE installiert. Installationspakete%smüssen Designzeit-Packages sein."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Dieses Package stellt das gleiche wie die folgenden Packages bereit:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update/Rebuild"
msgstr "Aktualisieren/Neukompilieren"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Bedienung"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Alles abbrechen"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Fortschritt"

#: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Eine Pascal-Unit muß die Endung .pp oder .pas haben"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Konflikt aufgetreten"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Virtuelle Unit bearbeiten"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Dateiname:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Dateischreibweisen korrigieren"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Ungültiger Unit-Dateiname"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Ungültiger Unit-Name"

#: lazarusidestrconsts.lispemovefiledown
msgid "Move file down"
msgstr "Datei nach unten bewegen"

#: lazarusidestrconsts.lispemovefileup
msgid "Move file up"
msgstr "Datei nach oben bewegen"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort files"
msgstr "Dateien sortieren"

#: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Es gibt schon eine Unit mit diesem Namen.%sDatei: %s"

#: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Der Unitname ist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Der Unitname wird gebraucht, wenn die IDE die Uses-Anweisung erweitert."

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Unit-Name:"

#: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Unitname und Dateiname passen nicht zusammen.%sBeispiel: unit1.pas und Unit1"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "CompiledSrcPath-Erweiterung"

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Ausgabeverzeichnis"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Package-Quellverzeichnismaske"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Unit-Pfad"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Wollen Sie die Änderungen am Packages %s wirklich verwerfen und es neu aus der Datei laden?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Die neue Unit ist nicht im Unitpfad"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Package veröffentlichen"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Package zurücknehmen?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?"
msgstr "Die Datei %s%s%s%sbefindet sich derzeit nicht im Unitpfad des Packages.%s%s. %s%s%s in den Unitpfad aufnehmen?"

#: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented
msgid "Online Help not yet implemented"
msgstr "Online-Hilfe noch nicht verfügbar"

#: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav
msgid "Right click on the items tree to get the popupmenu with all available package functions."
msgstr "Rechtsklick auf den Baum der Einträge zeigt das Popup-Menü mit allen verfügbaren Package-Funktionen."

#: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu
msgid "There are more functions in the popupmenu"
msgstr "Das Popup-Menü enthält mehr Funktionen"

#: lazarusidestrconsts.lispkgfiletypebinary
msgid "Binary"
msgstr "Binär"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Include-Datei"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Ausgaben-XML-Datei"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus-Formtext"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus-Ressource"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Haupt-Unit"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Text"

#: lazarusidestrconsts.lispkgfiletypeunit
msgctxt "lazarusidestrconsts.lispkgfiletypeunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Virtuelle Unit"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s%s"
msgstr "%sFüge neue Abhängigkeit für Package %s hinzu: Package %s%s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s%s"
msgstr "%sFüge neue Abhängigkeit für Projekt %s hinzu: Package %s%s"

#: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit
msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases."
msgstr "Füge Unit zum Uses-Abschnitt des Packages. Schalten Sie dies nur bei Units ab, die nicht auf jeden Fall kompiliert werden sollen."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Mehrdeutige Units gefunden"

#: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound
msgid "A required packages was not found. See package graph."
msgstr "Ein benötigtes Package wurde nicht gefunden. Bitte überprüfen Sie den Package-Graphen."

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatisch installierte Packages"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sBeide Packages sind verbunden. Das bedeutet, daß entweder das eine Package das andere verwendet oder beide ein drittes."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Abhängigkeit nicht erfüllt"

#: lazarusidestrconsts.lispkgmangcircleinpackagedependencies
msgid "Circle in package dependencies"
msgstr "Zirkuläre Abhängigkeiten in den Packages"

#: lazarusidestrconsts.lispkgmangcompilingpackage
msgid "Compiling package %s"
msgstr "Kompiliere Package %s"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Löschen fehlgeschlagen"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Alte Package-Datei löschen?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file %s%s%s?"
msgstr "Alte Package-Datei %s%s%s löschen?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Abhängigkeit ohne Eigentümer: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Fehler beim Lesen der Datei"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Fehler beim Lesen des Packages"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Fehler: Update der po Dateien für Package %s fehlgeschlagen"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Fehler beim Schreiben der Datei"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Fehler beim Schreiben des Packages"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Datei bereits im Package"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Datei ist im Projekt enthalten"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Dateiname unterscheidet sich vom Package-Namen"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Dateiname wird von anderem Package bereits verwendet"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Dateiname ist vom Projekt verwendet"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgid "File %s%s%s not found."
msgstr "Datei %s%s%s nicht gefunden,"

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Datei nicht gesichert"

#: lazarusidestrconsts.lispkgmangignoreandsavepackagenow
msgid "Ignore and save package now"
msgstr "Übergehen und Package jetzt speichern"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Die Installation des Packages %s installiert automatisch das Package:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Die Installation des Packages %s installiert automatisch die Packages:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "ungültiger Compilerdateiname"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Ungültige Dateiendung"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Ungültige Package-Dateiendung"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Ungültiger Package-Dateiname"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Ungültiger Package-Name"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Ungültiger Package-Name"

#: lazarusidestrconsts.lispkgmanglazarus
msgctxt "lazarusidestrconsts.lispkgmanglazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?"
msgstr "Das Laden des Packages %s wird das Package %s%saus der Datei %s ersetzen.%sDas alte Package wurde geändert.%s%sAltes Package %s speichern?"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "Neues Package"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Package: %s"

#: lazarusidestrconsts.lispkgmangpackagechangedsave
msgid "Package %s%s%s changed. Save?"
msgstr "Package %s%s%s wurde geändert. Speichern?"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Package-Konflikte"

#: lazarusidestrconsts.lispkgmangpackagefilemissing
msgid "Package file missing"
msgstr "Package-Datei fehlt"

#: lazarusidestrconsts.lispkgmangpackagefilenotsaved
msgid "Package file not saved"
msgstr "Package-Datei nicht gespeichert"

#: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory
msgid "Package %s%s%s has no valid output directory:%s%s%s%s"
msgstr "Package %s%s%s hat kein gültiges Ausgabeverzeichnis:%s%s%s%s"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is no designtime package"
msgstr "Das ist kein Entwicklungszeit-Package"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Package wird benötigt"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "Package-Hauptquelldatei"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Package-Name ist bereits belegt"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Packages müssen die Endung .lpk besitzen"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Bitte speichern Sie die Datei vor dem Einfügen in ein Package."

#: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst
msgid "Please save the package first."
msgstr "Bitte sichern Sie zuerst das Package."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Lazarus neu kompilieren?"

#: lazarusidestrconsts.lispkgmangrenamefileinpackage
msgid "Rename file in package?"
msgstr "Datei im Package umbenennen?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Datei in Kleinbuchstaben umbenennen?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file %s%s%s?"
msgstr "Ersetzen der vorhandenen Datei %s%s%s?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Ersetze Datei"

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save Package?"
msgstr "Package speichern?"

#: lazarusidestrconsts.lispkgmangsavepackage2
msgid "Save package?"
msgstr "Package speichern?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Package %s (*.lpk) speichern?"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s%s%s%s?"
msgstr "Soll die Datei in Kleinbuchstaben nach%s%s%s%sumbenannt werden?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Dieses Package übergehen"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Konfigurationsdatei für statische Packages"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Die Compilerdatei des Packages %s ist keine gültige ausführbare Datei:%s%s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file %s%s%s%sis already in the package %s."
msgstr "Die Datei %s%s%s%s befindet sich bereits im Package %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file %s%s%s is not a lazarus package."
msgstr "Die Datei %s%s%s ist kein Lazarus-Package."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?"
msgstr "Der Dateiname %s%s%s stimmte nicht dem Package-Namen %s%s%s in der Datei überein.%sSoll der Name des Packages auf %s%s%s geändert werden?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files."
msgstr "Der Dateiname %s%s%s ist Teil des aktuellen Projekts.%sProjekte und Packages sollten keine gemeinsamen Dateien haben."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s."
msgstr "Der Dateiname %s%s%s wird von%sdem Package %s%s%s%sin der Datei %s%s%s genutzt."

#: lazarusidestrconsts.lispkgmangthefileofpackageismissing
msgid "The file %s%s%s%sof package %s is missing."
msgstr "Die Datei %s%s%s%sdes Packages %s fehlt."

#: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst
msgid "The file %s%s%s%sof package %s needs to be saved first."
msgstr "Die Datei %s%s%s%sdes packages %s muß zuerst gespeichert werden"

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Das folgende Package konnte nicht geladen werden:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Die folgenden Packages konnten nicht geladen werden:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s"
msgstr "%sDie folgenden Units werden zum Uses-Abschnitt von%s%s zugefügt:%s%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?"
msgstr "Das Package %s%s%s konnte nicht kompiliert werden.%sAus der Installationsliste nehmen?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name."
msgstr "Der Package-Dateiname %s%s%s in%s%s%s%s ist kein gültiger Lazarus-Package-Name."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE."
msgstr "Das Package %s ist ein Nur-Laufzeit-Package.%sLaufzeit-Packages können nicht in die IDE installiert werden."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?"
msgstr "Das Package %s%s%s ist für die Installation vermerkt, kann aber nicht gefunden werden.%sSoll die Abhängigkeit von der Installationsliste der Packages entfernt werden?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgstr "Das Package %s wird von %s benötigt, das für Installation vermerkt ist.%Siehe Package-Graph."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Der Packagename %s%s%s ist kein gültiger Packagename%sBitte wählen Sie einen anderen (z.B. package1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name %s%s%s of%sthe file %s%s%s is invalid."
msgstr "Der Packagename %s%s%s der%sDatei %s%s%s ist ungültig."

#: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed
msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?"
msgstr "Das Package %s besitzt die Datei%s%s%s%s.%sSoll die Datei im Package ebenfalls umbenannt werden?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Das Package %s%s%s war markiert.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Eine echte Deinstallation verlangt das Kompilieren und den Neustart von Lazarus.%s%sWollen Sie Lazarus jetzt neu kompilieren?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?"
msgstr "Das Package %s%s%s war für die Installation markiert.%sDerzeit unterstützt Lazarus nur statisch gelinkte Packages. Die echte Installation verlangt das Kompilieren und den Neustart von Lazarus.%s%sWollen Sie Lazarus jetzt neu kompilieren?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector."
msgstr "Das Projekt benötigt das Package %s%s%s.%sEs wurde aber nicht gefunden. Siehe Projekt->Projekinspektor."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s"
msgstr "Es gibt zwei Units mit demselben Namen:%s%s1. %s%s%s von %s%s2. %s%s%s von %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages
msgid "There is a circle in the required packages. See package graph."
msgstr "Es ist ein Ringschluß in den benötigten Packages. Siehe Package-Graph."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s"
msgstr "Es gibt eine FPC-Unit mit gleichem Namen wie ein Package:%s%s%s%s%s%s"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s"
msgstr "Es gibt eine FPC-Unit mit dem selben Namen wie:%s%s%s%s%s aus %s%s%s "

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s"
msgstr "Es gibt bereits ein Package mit dem Namen %s%s%s.%sPackage-Konflikt: %s%s%s%sDatei: %s%s%s"

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible."
msgstr "Es ist bereits ein Package %s%s%s aus der Datei %s%s%s geladen.%sSiehe Komponenten->Package-Graph.%sErsetzen ist nicht möglich."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Das benötigte Package enthält ein ungesichertes Package. Siehe Package-Graph."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s"
msgstr "Es gibt bereits eine Unit mit dem gleichen Namen wie ein Package:%s%s1. %s%s%s aus %s%s2. %s%s%s%s"

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Das ist ein virtuelles Packages. Es besitzt, solange es noch nicht gespeichert wurde, keinen Quelltext. Bitte speichern Sie es zuerst."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Unfähig, das Verzeichnis anzulegen"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory %s%s%s%sfor package %s."
msgstr "Kann Ausgabeverzeichnis %s%s%s%sfür das Package %s nicht erzeugen."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory %s%s%s%sfor package %s."
msgstr "Kann das Package-Quelltextverzeichnis %s%s%s%s für das Package %s nicht erzeugen."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages."
msgstr "Kann kein Zielverzeichnis für Lazarus erzeugen:%s%s%s%s.%sDieses Verzeichnis wird für die gerade geänderte Lazarus-IDE und ihre benutzerdefinierten Packages benötigt."

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file %s%s%s."
msgstr "Die Datei %s%s%s kann nicht gelöscht werden."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Kann die Datei nicht löschen"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file %s%s%s%sfor package %s."
msgstr "Die alte Statusdatei %s%s%s%sdes Packages %s kann nicht gelöscht werden."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Kann Package nicht laden"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package %s%s%s.%sThis package was marked for installation."
msgstr "Das Package %s%s%s.%s kann nicht geöffnet werden. Es war zur Installation vermerkt."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s"
msgstr "Die Statusdatei %s%s%s%sdes Packages %s kann nicht gelesen werden.%sFehler: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s"
msgstr "Kann Package %s%s%s%snicht in die Datei %s%s%s schreiben.%sFehler: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s"
msgstr "Kann Statusdatei %s%s%s%sdes Packages %s nicht schreiben.%sFehler: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Package entfernen?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Package %s entfernen?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Nichtgespeichertes Package"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Verwende Unit"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file %s%s%s%sbelongs to the current project."
msgstr "Warnung: Die Datei %s%s%s%sgehört zum aktuellen Projekt."

#: lazarusidestrconsts.lispkgreg
msgid "Package Registration"
msgstr "Package-Registrierung"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Can not register components without unit"
msgstr "Kann Komponenten nicht ohne Unit registrieren"

#: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc
msgid "CodeTools - tools and functions to parse, browse and edit pascal sources"
msgstr "CodeTools - Werkzeuge und Funktionen, um Pascal Quelltexte zu analysieren, zu durchsuchen und zu bearbeiten"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class %s%s%s already defined"
msgstr "Komponentenklasse %s%s%s bereits definiert"

#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: %s%s%s"
msgstr "%s%sDateiname: %s%s%s"

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Ungültige Komponentenklasse"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Ungültiger Unit-Name: %s"

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Package-Konflikte"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Registerprozedur ist NIL"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called, but no package is registering."
msgstr "RegisterUnit wurde aufgerufen aber es wurde kein Package registriert."

#: lazarusidestrconsts.lispkgsysregistrationerror
msgid "Registration Error"
msgstr "Registrierungsfehler"

#: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus
msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/"
msgstr "SynEdit - die von Lazarus eingesetzte Editorkomponente. http://sf.net/projects/synedit/"

#: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase
msgid "The FCL - FreePascal Component Library provides the base classes for object pascal."
msgstr "Die FCL (Free Pascal Component Library) enthält die Basisklassen für Object Pascal."

#: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase
msgid "The LCL - Lazarus Component Library contains all base components for form editing."
msgstr "Die LCL (»Lazarus Component Library«) enthält alle Basiskomponten um Formulare zu bearbeiten."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Das Package %s%s%s ist installiert, es gibt aber keine gültige Package-Datei (.lpk).%sEs wurde ein defektes Dummy-Package erzeugt."

#: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase
msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs."
msgstr "Die RTL - Die Laufzeitumgebung ist die Basis aller Free-Pascal-Programme."

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Das ist das Standard-Package nur für Komponenten ohne Package. Solche Komponenten sind veraltet."

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Dieses Package ist installiert, aber die lpk-Datei wurde nicht gefunden. Alle enthaltenen Komponenten sind abgeschaltet. Bitte beheben Sie den Fehler."

#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: %s%s%s"
msgstr "%s%sUnit-Name: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitnotfound
msgid "Unit not found: %s%s%s"
msgstr "Unit nicht gefunden: %s%s%s"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage
msgid "Unit %s%s%s was removed from package"
msgstr "Unit %s%s%s wurde aus dem Package entfernt"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Die Datei gibt es ist in keinem der geladenen Packages."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file %s%s%s.%sError: %s"
msgstr "Kann Package-Datei %s%s%s nicht lesen.%sFehler: %s"

#: lazarusidestrconsts.lispldexists
msgid "Exists"
msgstr "Vorhanden"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Allgemein"

#: lazarusidestrconsts.lispldonlyexistingfiles
msgid "Only existing files"
msgstr "Nur vorhandene Dateien"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Package-Links"

#: lazarusidestrconsts.lispldshowgloballinks
msgid "Show global links"
msgstr "Zeige globale Verknüpfungen"

#: lazarusidestrconsts.lispldshowuserlinks
msgid "Show user links"
msgstr "Zeige benutzerdefinierte Verknüpfungen"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Benutzer"

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Btte öffnen Sie eine Unit vor dem Starten."

#: lazarusidestrconsts.lispleaseselectabuildmodefirst
msgid "Please select a build mode first."
msgstr "Bitte wählen Sie zuerst einen Kompilerungsmodus."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Bitte wählen Sie den Quelltext, um eine neue Prozedur/Methode zu extrahieren."

#: lazarusidestrconsts.lisplistall
msgid "<All>"
msgstr "<Alle>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Schriftart ändern"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Methodenname in die Zwischenablage kopieren"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtern, wenn ein beliebiger Bereich der Methode paßt"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtern, wenn der Methodenstart paßt"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Zur Auswahl springen"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Keine>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objekte"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Prozedur-Liste"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Typ"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ".po-Datei-Verzeichnis auswählen"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Keine Sitzungs-Informationen speichern"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Zeiger"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in IDE config directory"
msgstr "Im IDE-Konfigurationsverzeichnis speichern"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "In lpi-Datei speichern"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "lps-Datei im Projektverzeichnis speichern"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Sitzungsinformationen speichern in"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Vorheriges Wort"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory, where Lazarus stores its config files. Default is "
msgstr "primäres Konfigurationsverzeichnis in dem Lazarus seine Konfigurationsdateien speichert. Voreinstellung ist"

#: lazarusidestrconsts.lisprint
msgid "Print"
msgstr "Drucken"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Private Methode"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy
#| msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s"
msgid "Probably you need to install some packages before continuing.%s%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%s%sIt is recommended to cancel and install these packages first.%s%s"
msgstr "Möglicherweise müssen sie einige Package installieren, um fortfahren zu können.%s%sWarnung:%sDas Projekt bezieht sich auf Packages, die Units mit Register-Prozeduren enthalten. Die Register-Prozedur dient normalerweise dazu, Komponenten in der IDE zu installieren. Aber die folgenden Units gehören zu Packages, die noch nicht in der IDE installiert sind. Wenn Sie versuchen, ein Form in der IDE zu öffnen, das solche Komponenten einbindet, werden Sie Fehlermeldungen wegen nicht gefundener Komponenten erhalten und der Ladeprozeß des Forms wird mit möglicherweise unschönen Ergebnissen enden.%s%sDas hat keinen Einfluß auf das Öffnen des Projekts oder beliebiger zugehörigen Quellen.%s%sEs bedeutet nur, daß es keine gute Idee ist, das Form für das Design zu öffnen bevor die bemängelten Packages installiert wurden.%s%s"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Prozedur"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Prozedur mit Schnittstelle"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programm"

#: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic
#| msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus."
msgid "Program%sA Free Pascal program. The program source is automatically maintained by Lazarus."
msgstr "Programm%sEin Free-Pascal-Programm. Der Programmquellcode wird automatisch von Lazarus gepflegt."

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programm ermittelt"

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a pascal extension like .pas, .pp or .lpr"
msgstr "Der Programmquelltext muß eine Pascal-Endung wie .pas, .pp oder .lpr besitzen"

#: lazarusidestrconsts.lisprojaddaddfilestoproject
msgid "Add files to project"
msgstr "Dateien zum Projekt hinzufügen"

#: lazarusidestrconsts.lisprojaddaddfiletoproject
msgid "Add file to project:"
msgstr "Datei ins Projekt aufnehmen:"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Abhängigkeit ist bereits vorhanden"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add editor files"
msgstr "Dateien hinzufügen"

#: lazarusidestrconsts.lisprojaddfiles
msgid "Add files"
msgstr "Dateien hinzufügen"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Ungültiger Min-/Max-Version"

#: lazarusidestrconsts.lisprojaddinvalidpackagename
msgid "Invalid packagename"
msgstr "Ungültiger Package-Name"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid pascal unit name"
msgstr "Ungültiger Pascaldateiname"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Ungültige Version"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Höchste  Versionsnummer (optional):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Niedrigste Versionsnummer (optional):"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Neue Anforderung"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Package-Name:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Package nicht gefunden"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency %s%s%s was not found.%sPlease choose an existing package."
msgstr "Die Abhängigkeit %s%s%s wurde nicht gefunden.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die maximale Versionsangabe %s%s%s ist ungültig.%sDas Format lautet Haupt.Unter.Ausgabe.Build%sBeispielsweise: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Die maximal benötigte Version ist kleiner als die minimale."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10"
msgstr "Die Minimalversionsangabe %s%s%s ist ungültig.%sBitte verwenden Sie das Format Major.Minor.Release.Build%sBeispielsweise: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag
msgid "The package name %s%s%s is invalid.%sPlase choose an existing package."
msgstr "Der Package-Name %s%s%s ist ungültig.%sBitte wählen Sie ein vorhandenes Package."

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package %s%s%s."
msgstr "Das Projekt besitzt bereits eine Abhängigkeit auf das Package %s%s%s."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s."
msgstr "Der Unit-Name %s%s%s ist bereits im Projekt%s mit der Datei: %s%s%s enthalten."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s."
msgstr "Der Unit-Name %s%s%s ist bereits der Auswahl%s mit der Datei: %s%s%s enthalten."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name %s%s%s is not a valid pascal identifier."
msgstr "Der Unit-Name %s%s%s ist kein gültiger Pascal-Bezeichner"

#: lazarusidestrconsts.lisprojaddtoproject
msgctxt "lazarusidestrconsts.lisprojaddtoproject"
msgid "Add to project"
msgstr "Ins Projekt aufnehmen"

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Unit-Name ist bereits vorhanden"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projekt verändert"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projekt auf Datenträger geändert"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Projektverzeichnis"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Titel im Taskbar zeigt auch den Verzeichnispfad des Projekts"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Projektdateiname"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Projekt-Include-Pfad"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Projekteinstellungsdatei gefunden"

#: lazarusidestrconsts.lisprojectinformation
msgid "Project Information"
msgstr "Projektinformation"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projekt ist lauffähig"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Projekt-Makroeigenschaften"

#: lazarusidestrconsts.lisprojectmacrounitpath
msgid "macro ProjectUnitPath"
msgstr "Makro ProjectUnitPath"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Projekt-Ausgabeverzeichnis (z.B. das ppu Verzeichnis)"

#: lazarusidestrconsts.lisprojectpath
msgid "Project Path:"
msgstr "Projektpfad:"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr ""

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Projekt %s hat Exception-Klasse »%s« ausgelöst."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projekt %s hat Exception-Klasse »%s« ausgelöst mit der Meldung:%s%s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Projekt-Quellpfad"

#: lazarusidestrconsts.lisprojectsuccessfullybuilt
#| msgid "Project %s%s%s successfully built. :)"
msgid "Project %s%s%s successfully built"
msgstr "Projekt %s%s%s erfolgreich kompiliert. :)"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "Projekt-Unit"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Projekt-Unitpfad"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Projektassistent"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Bestätigen Sie das Löschen der Abhängigkeit"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Löschen der Datei bestätigen"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Löschen der Abhängigkeit für %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Projektinspektor - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgid "Removed required packages"
msgstr "Benötigte Packages entfernt"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Entfernen der Datei %s aus dem Projekt?"

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Die Statusdatei %s des Projekts %s kann nicht gelesen werden%sFehler: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Kann Statusdatei für das Projekt %s nicht schreiben%sFehler: %s"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Immer einen Compilerlauf durchführen (selbst dann, wenn nichts geändert wurde)"

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Fehler"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Kann die Liste der automatischen anzulegenden Forms im Programmquelltext nicht ändern.%sBitte beheben Sie zuerst die Fehler."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Projekt-Quellverzeichnismarke"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Benutzer nach Daten fragen"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Eigenschaften (ersetzen oder entfernen"

#: lazarusidestrconsts.lispropertiesofconditionalcompileroption
msgid "Properties of conditional compiler option"
msgstr "Eigenschaften der bedingten Compilereinstellungen"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Protected-Methode"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Public-Methode (öffentlich)"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Veröffentlichte Methode"

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Veröffentliche Projektverzeichnis"

#: lazarusidestrconsts.lispublprojinvalidexcludefilter
msgid "Invalid Exclude filter"
msgstr "Ungültiger Ausschlußfilter"

#: lazarusidestrconsts.lispublprojinvalidincludefilter
msgid "Invalid Include filter"
msgstr "Ungültiger Include-Filter"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ".lrs-Datei in das Ausgabeverzeichnis speichern"

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A pascal unit must have the extension .pp or .pas"
msgstr "Eine Pascal-Unit muß die Erweiterung ».pp« oder ».pas« haben"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Virtuelle Unit bearbeiten"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Es gibt bereits eine Unit mit dem Namen. %sDatei: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid pascal identifier."
msgstr "Der Unit-Name ist kein gültiger Pascal-Bezeichner."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses."
msgstr "Der Unit-Name wird beim Erweitern der Uses-Klausel von der IDE verwendet."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Unit-Name und Dateiname passen nicht zusammen.%sBeispiel: unit1.pas und Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert Delphi Project"
msgstr "Delphi-Projekt umwandeln"

#: lazarusidestrconsts.lispwnewproject
msgid "New Project"
msgstr "Neues Projekt"

#: lazarusidestrconsts.lispwopenproject
msgid "Open Project"
msgstr "Projekt öffnen"

#: lazarusidestrconsts.lispwopenrecentproject
#, fuzzy
#| msgid "Open Recent"
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open Recent Project"
msgstr "Wieder öffnen"

#: lazarusidestrconsts.lisquickfixcreatelocalvariable
msgid "Create local variable"
msgstr "Erzeuge lokale Variable"

#: lazarusidestrconsts.lisquickfixes
#, fuzzy
msgid "Quick fixes"
msgstr "Schnelle Fixes"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr ""

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Suche Bezeichner"

#: lazarusidestrconsts.lisquitlazarus
msgid "Quit Lazarus"
msgstr "Lazarus beenden"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Lesefehler"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Record/Struktur"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Register"

#: lazarusidestrconsts.lisregistersdlgname
msgctxt "lazarusidestrconsts.lisregistersdlgname"
msgid "Name"
msgstr "Name"

#: lazarusidestrconsts.lisregistersdlgvalue
msgctxt "lazarusidestrconsts.lisregistersdlgvalue"
msgid "Value"
msgstr "Wert"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Regulärer Ausdruck"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Relative Pfade"

#: lazarusidestrconsts.lisremove
msgid "remove"
msgstr "entfernen"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Entfernen aller ungültigen Eigenschaften"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Alle Units entfernen"

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Aus Installationsliste entfernen"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from project"
msgstr "Vom Projekt entfernen"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Aus dem Suchpfad entfernen"

#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Lokale Variable %s entfernen"

#: lazarusidestrconsts.lisremovelocalvariable2
msgid "Remove local variable"
msgstr "Lokale Variable entfernen"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove non existing files"
msgstr ""

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Gewählte Units entfernen"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Entfernen"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr ""

#: lazarusidestrconsts.lisremoveunitfromusessection
msgid "Remove unit from uses section"
msgstr "Unit aus der Sektion <Uses> entfernen"

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Datei umbenennen?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Umbenennen der Datei ist fehlgeschlagen"

#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Zu %s umbenennen"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "In Kleinbuchstaben umbenennen"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Projekt erneut öffnen"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Mit anderer Kodierung erneut lesen"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Wiederholungen:"

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Ersetzung"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr ""

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Ersetzungen"

#: lazarusidestrconsts.lisreplaceremoveunknown
#, fuzzy
#| msgid "Replace unknown types and properties"
msgid "Fix unknown properties and types"
msgstr "Unbekannte Typen und Eigenschaften ersetzen"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Das Ersetzen der Auswahl ist gescheitert."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrequiresfpc24orabovelikedelphiresources
msgid "Requires FPC 2.4 or above. Like Delphi resources"
msgstr "Benötigt FPC 2.4 oder höher. Wie Delphi-Ressourcen"

#: lazarusidestrconsts.lisrescan
#, fuzzy
msgid "Rescan"
msgstr "Neuscan"

#: lazarusidestrconsts.lisresourceloaderror
msgid "Resource load error"
msgstr "Ressourcen-Ladefehler"

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Ressourcen-Schreibfehler"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project:"
msgstr "Ressourcentyp des Projekts:"

#: lazarusidestrconsts.lisresponsecontinue
msgid "Response: %sContinue ?"
msgstr "Antwort: %sWeiter ?"

#: lazarusidestrconsts.lisresult
msgid "Result :="
msgstr "Result :="

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Ergebnis:"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid "returns list of all values of case variable in front of variable"
msgstr "gibt die Liste aller Werte der Case-Variable vor der Variable zurück"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Rücknahme fehlgeschlagen"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Rechts"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Rechte Verankerung"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Rechter Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz rechts vom Element verwendet."

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol, an das die rechte Seite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Rechte Seiten"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Rechter Abstand gleich"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Wurzel"

#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr ""

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Datei ist nicht ausführbar"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application %s%s%s is not executable."
msgstr "Die Hostapplikation %s%s%s ist nicht ausführbar"

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Gehezu fehlgeschlagen"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract methods - not yet overridden"
msgstr "Abstrakte Methoden - noch nicht überschrieben"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Abstrakte Methoden von %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Cursor befindet sich nicht in einer Klassendeklaration"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE ist beschänftigt"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s ist eine abstrakte Klasse und hat %s abstrakte Methoden."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Keine abstrakten Methoden gefunden"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Alle Auswahlen überschreiben"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Erste Auswahl überschreiben"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Keine auswählen"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Es müssen %s abstrakte Methoden überschrieben werden.%sWählen Sie die Methoden, für die Rümpfe erzeugt werden sollen:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Es sind keine abstrakten Methoden für das Überschreiben übrig."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Diese Methode kann nicht überschrieben werden, da sie in der aktuellen Klasse definiert ist."

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Kann die abstrakten Methoden der aktuellen Klasse nicht anzeigen, weil"

#: lazarusidestrconsts.lissave
msgid "Save ..."
msgstr "Speichern ..."

#: lazarusidestrconsts.lissaveallmessagestofile
msgid "Save all messages to file"
msgstr "Alle Meldungen in Datei speichern"

#: lazarusidestrconsts.lissaveallmodified
msgid "save all modified files"
msgstr "Alles speichern"

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Speichern und Dialog beenden"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Speichern und IDE rekompilieren"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Änderungen speichern?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Änderungen in Projekt %s speichern?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "save current editor file"
msgstr "Aktuelle Datei im Editor speichern"

#: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles
msgid "Save editor info of non project files"
msgstr "Editorinformationen von Nicht-Projekt-Dateien sichern"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Datei speichern als"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file %s%s%s%sbefore closing form %s%s%s?"
msgstr "Speichern der Datei %s%s%s%svor dem Schließen des Formulars %s%s%s?"

#: lazarusidestrconsts.lissaveinfoofclosededitorfiles
msgid "Save info of closed editor files"
msgstr "Info geschlossener Editordateien speichern"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Projekt %s speichern (*%s)"

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Einstellungen sichern"

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Speichere "

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Skalierungsfaktor:"

#: lazarusidestrconsts.lissearchfor
msgid "Search For "
msgstr "Suche nach"

#: lazarusidestrconsts.lissearchunit
msgid "Search unit"
msgstr "Unit suchen"

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgstr "sekundäres Konfigurationsverzeichnis in dem Lazarus nach Vorlagendateien sucht. Voreinstellung ist"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Siehe Meldungen"

#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sSiehe Projekt -> Projektinspektor"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Hilfeeintrag auswählen"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Eintrag wählen"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Delphi-Formulardatei (*.dfm) auswählen"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Ausgewählt"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(unteren Nachbarn auswählen)"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(linken Nachbarn auswählen)"

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(rechten Nachbarn auswählen)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(oberen Nachbarn auswählen)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Die Datei auswählen"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Auswahl überschreitet Stringkonstante"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Auswahlwerkzeug"

#: lazarusidestrconsts.lisselecttheactivebuildmode
msgid "Select the active build mode"
msgstr "Aktiven Kompiliermodus wählen"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Voreinstellungens setzen"

#: lazarusidestrconsts.lissetmacrovalues
msgid "Set macro values"
msgstr "Makrowerte setzen"

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Setup default indentation)"
msgstr "(Standard-Einrückung festlegen)"

#: lazarusidestrconsts.lissetvalue
msgid "Set value"
msgstr "Wert festlegen"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Kurz:"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Zeigen"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Deklarations Hinweise anzeigen"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Zeige Unterschiede zwischen den Modi..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Leere Units/Packages anzeigen"

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for:"
msgstr "Zeige Bildzeichen für:"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Trennlinie anzeigen"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgid "Show hints"
msgstr "Anzeigen der Hinweise im Objektinspektor"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Bezeichner anzeigen"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Infobox anzeigen"

#: lazarusidestrconsts.lisshowoldtaborder
msgid "Show old tab order"
msgstr "Zeige alte Tabulatorreihenfolge"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Packages anzeigen"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Sonderzeichen anzeigen"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show status bar"
msgstr "Statusbalken anzeigen"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Units anzeigen"

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Werte-Hinweise während des Debuggens anzeigen"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Version anzeigen und Ende"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Zum Kleinsten schrumpfen"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Geschwister"

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple Syntax"
msgstr "Einfache Syntax"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Datei überspringen"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Datei übergehen und das Laden fortsetzen"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Das Laden des letzten Projekts übergehen"

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "smaller rather than faster"
msgstr "Lieber kleiner als schneller"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Treffer"

#: lazarusidestrconsts.lissorrynotimplementedyet
msgid "Sorry, not implemented yet"
msgstr "Noch nicht implementiert"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Entschuldigung, dieser Typ ist (noch) nicht implementiert"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Aufsteigend"

#: lazarusidestrconsts.lissortselcancel
msgctxt "lazarusidestrconsts.lissortselcancel"
msgid "Cancel"
msgstr "Abbrechen"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Klein/groß beachten"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Absteigend"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domain"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Leerzeichen übergehen"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Zeilen"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Einstellungen"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Absätze"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Vorschau"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Annehmen"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Auswahl sortieren"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Worte"

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Quelle und Ziel sind gleich:%s%s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source breakpoint"
msgstr "&Quell-Haltepunkt"

#: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema
msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it."
msgstr "Quellverzeichnis %s%s%s%sund Zielverzeichnis %s%s%s%ssind identisch.%s%sSie haben vielleicht diese Funktion falsch verstanden.%sSie reinigt bzw. legt das Zielverzeichnis neu an%sund kopiert das Package/Projekt dorthin."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory %s%s%s does not exist."
msgstr "Das Quellverzeichnis %s%s%s ist nicht vorhanden."

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Quelltext geändert"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page %s%s%s has changed. Save?"
msgstr "Der Quelltext der Seite %s%s%s wurde ändert. Speichern?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveextended
msgid "Sources of more than one page have changed. Save page %s%s%s? (%d more)"
msgstr ""

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Quelltext-Pfade"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Gleichmäßig aufteilen"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Quell-OS"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Suche"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Suchtext"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Konvertierung beginnen"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Mit einem neuen Projekt beginnen"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Das Debugging abbrechen und das Projekt neu erzeugen?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Debuggen abbrechen?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Debuggiung beenden?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Bei Ausnahmen anhalten"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Debuggen abbrechen?"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Sonderbare .lpi-Datei"

#: lazarusidestrconsts.lisstreamerror
msgid "Stream Error"
msgstr "Stream-Fehler"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Streaming-Fehler"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "String"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Stil"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Unterprozedur"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Unterprozedur derselben Stufe"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Erfolg"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Verdächtiger Include-Pfad"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Verdächtiger Unit-Pfad"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN-Revision: "

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Ungültiger Variablenname"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "%s%s%s is not a valid identifier."
msgstr "%s%s%s ist als Bezeichner ungültig."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Systemvariablen überschreiben"

#: lazarusidestrconsts.lissynedit
msgid "SynEdit"
msgstr "SynEdit"

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Syntax-Modus"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts.listaborderof
msgid "Tab Order of"
msgstr "Tabulatorreihenfolge von"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Zielprozessor"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Ziel-Dateiname: (-o, leer = verwende Unit-Ausgabeverzeichnis)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Ziel-Dateiname (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Zieldateiname des Projekts"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Zieldateiname + Parameter"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Zielbetriebssystem"

#: lazarusidestrconsts.listcompilerinternalerror
msgid "Internal compiler error! (%d)"
msgstr "Interner Compilerfehler! (%d)"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Bearbeitbare Zelle"

#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid ""
"Inserts an editable Cell, with a default value\n"
"\"\",Sync=n (,S=n), to Sync with a previous cell (n=1 to highest prev cell\n"
"\"default\",Sync, to Sync with a previous cell of equal default\n"
msgstr ""
"Fügt eine bearbeitbare Zelle mit einem Defaultwert ein\n"
"»«,Sync=n (,S=n), um mit einer vorherigen Zelle zu synchronisieren (n=1 zur höchsten vorherigen Zelle\n"
"»default«,Sync,um mit einer vorherigen Zelle mit dem gleichen Defaultwert zu synchronisieren\n"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Testverzeichnis"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Das Application-Bundle wurde erzeugt für \"%s\""

#: lazarusidestrconsts.listhebuildmacrodoesnotbeginwith
msgid "The build macro \"%s\" does not begin with \"%s\"."
msgstr "Das Erstellmakro \"%s\" beginnt nicht mit \"%s\"."

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste."
msgstr "Die Klasse %s%s%s ist ein TControl und kann nicht auf ein Nicht-Control kopiert werden.%sKann Paste nicht durchführen."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The codetools found an error:%s%s%s"
msgstr "Die Codetools fanden einen Fehler:%s%s%"

#: lazarusidestrconsts.listhecommandafterisnotexecutable
msgid "The command after %s%s%s is not executable."
msgstr "Der Befehl nach %s%s%s ist nicht ausführbar."

#: lazarusidestrconsts.listhecommandafterpublishingisinvalid
msgid "The command after publishing is invalid:%s%s%s%s"
msgstr "Der nach dem Veröffentlichen auszuführende Befehl ungültig:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted, because it is not owned by %s."
msgstr "Die Komponente %s kann nicht gelöscht werden, da sie nicht %s gehört."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class %s%s%s has created the error:%s%s%s%s"
msgstr "Der Komponenteneditor der Klasse %s%s%s hat einen Fehler erzeugt:%s%s%s%s"

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s"
msgstr "Der Komponenteneditor der Klasse %s%s%s%s, aufgerufen mit dem Verb #%s %s%s%s%s hat den folgenden Fehler erzeugt:%s%s%s%s"

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Die Komponente %s ist von %s abgeleitet.%sEine abgeleitete Komponente wird in ihrem Vorfahr gelöscht."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Die Komponente %s ist von %s abgeleitet.%sUm eine abgeleitete Komponente umzubenennen wird der Vorfahr geöffnet und sie hier umbenannt."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal pascal identifier."
msgstr "Alle Komponenten auf dem Form/Datamodul müssen einen eindeutigen Namen besitzen. Er ist wie jeder Pascal-Bezeichner schreibweisenunabhängig."

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Der aktuelle Compilerdateiname %s%s%s%sist keine gültige ausführbare Datei.%sDrücken Sie »Ok«, um mit der Voreinstellung %s%s%szu arbeiten.%sSonst überprüfen Sie Einstellungen->Umgebungseinstellungen->Dateien"

#: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease
msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files"
msgstr "Der aktuelle Compiler-Dateiname %s%s%s%sist keine gültige ausführbare Datei.%sBitte prüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Das aktuelle Free Pascal-Quelltextverzeichnis %s%s%s%ssieht nicht richtig aus.%sMit »OK« wählen Sie die Voreinstellung %s%s%s.%sSonst überprüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2
msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files"
msgstr "Das aktuelle Free Pascal-Quelltextverzeichnis %s%s%s%ssieht nicht richtig aus.%sÜberprüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files"
msgstr "Das aktuelle Lazarus-Verzeichnis %s%s%s%ssieht nicht richtig aus.%sOhne es können keine LCL-Programme geschrieben werden.%sMit »OK« setzen Sie die Voreinstellung %s%s%s.%sSonst überprüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2
msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files"
msgstr "Das aktuelle Lazarus-Verzeichnis %s%s%s%ssieht nicht korrekt aus.%sOhne es können keine LCL-Programme geschrieben werden.%sÜberprüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits
msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory."
msgstr "Der aktuelle Unitpfad der Datei %s%s%s%sist%s%s%s%s.%s%s Der Pfad zu den LCL-Units %s%s%s fehlt.%s%sHinweis für Einsteiger:%sErzeugen Sie eine Lazarus-Applikation und legen Sie die Datei ins Projektverzeichnis."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options"
msgstr "Der Debugger %s%s%s%sfehlt oder ist nicht ausführbar.%s%sSiehe: Umgebung -> Debuggereinstellungen"

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s%s%s%s does not exist."
msgstr "Das Zielverzeichnis%s%s%s%s ist nicht vorhanden."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Es gibt das Zielverzeichnis %s%s%s nicht.%sBitte prüfen Sie den Namen des Projektziels im Menü Projekt > Projekteinstellungen."

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?"
msgstr "Das Verzeichnis %s%s%s wird nicht länger im Unit-Pfad benötigt.%sEntfernen?"

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory %s%s%s is not writable."
msgstr "Im Verzeichnis %s%s%s kann nicht geschrieben werden."

#: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit
msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?"
msgstr "Das Verzeichnic %s%s%s ist noch nicht im Unit-Pfad.%sAufnehmen?"

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Das Verzeichnis %s wurde nicht gefunden."

#: lazarusidestrconsts.listhefile
msgid "The file %s%s%s"
msgstr "Die Datei %s%s%s"

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Die Datei %s sieht nicht wie eine .lpi-Datei aus."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr ""

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?"
msgstr "Die Datei %s%s%s ist ein Symlink.%s%sStatt dessen %s%s%s öffnen?"

#: lazarusidestrconsts.listhefileisnotadelphiprojectdpr
msgid "The file %s%s%s is not a Delphi project (.dpr)"
msgstr "Die Datei %s%s%s ist kein Delphi-Projekt (.dpr)"

#: lazarusidestrconsts.listhefileisnotadelphiunit
msgid "The file %s%s%s is not a Delphi unit."
msgstr "Die Datei %s%s%s ist keine Delphi-Unit"

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file %s%s%s is not a lazarus project.%sCreate a new project for this %s?"
msgstr "Die Datei %s%s%s ist kein Lazarus-Projekt.%sEin neues Projekt für %s anlegen?"

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Die Datei %s%s%s%sscheint ein Programm zu sein. Aktuelles Projekt schließen und ein neues Lazarus-Projekt für dieses Programm erzeugen?%s»Nein« lädt die Datei als normalen Quelltext."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing lazarus Project."
msgstr "Die Datei %s scheint die Programmdatei eines vorhandenen Lazarus-Projekts zu sein"

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?"
msgstr "Die Datei %s%s%s%sdie in einem der Quellverzeichnisses des Packages %s gefunden wurde sieht wie eine kompilierte Unit aus. Kompilierte Units müssen sich im Ausgabeverzeichnis des Packages befinden, sonst kann das zu Problemen mit diesem Package führen.%s%sDie zweifelhafte Datei löschen?"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s"
msgstr "Die Datei %s%s%s%swurde nicht gefunden.%sWollen Sie selbst nach ihr suchen?%s"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Die Datei %s%s%s%swurde nicht gefunden.%s »Übergehen« lädt das Projekt weiter,%s»Abbruch« beendet den Ladevorgang."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "Der erste Erstellmodus ist der Vorgabemodus und muß im Projekt gespeichert werden, nicht in der Sitzung."

#: lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2
msgctxt "lazarusidestrconsts.listhefirstbuildmodeisthedefaultmodeandmustbestoredin2"
msgid "The first build mode is the default mode and must be stored in the project, not in the session."
msgstr "Der erste Erstellmodus ist der Vorgabemodus und muß im Projekt gespeichert werden, nicht in der Sitzung."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?"
msgstr "Die folgenden Methoden, die von %s verwendet werden sind nicht im Quelltext%s%s%s%s%s%sDie hängenden Verweise löschen?"

#: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm
msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc."
msgstr "Der Free Pascal-Compiler (Dateiname: %s) wurde nicht gefunden.%sEs wird empfohlen, FPC zu installieren."

#: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun
msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files"
msgstr "Das Free-Pascal-Quelltextverzeichnis wurde nicht gefunden.%sEinige Quelltextfunktionen werden nicht funktionieren.%sEs wird empfohlen, den FPC-Quelltext zu installieren und den Pfad darauf zu setzen, und zwar unter%sEinstellungen->Umgebungseinstellungen->Dateien"

#: lazarusidestrconsts.listhegnudebuggerthroughsshallowstoremotedebugviaassh
msgid "The GNU debugger through ssh allows to remote debug via a ssh connection. See docs/RemoteDebugging.txt for details. The path must contain the ssh client filename, the hostname with an optional username and the filename of gdb on the remote computer. For example: %s/usr/bin/ssh username@hostname gdb%s or: %s/usr/bin/setsid /usr/bin/ssh username@hostname gdb%s"
msgstr ""

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Der Bezeichner ist eine Unit. Bitte benennen sie eine Unit mit Datei -> Speichern unter ... um"

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?"
msgstr "Die Taste %s%sist bereits %s zugewiesen.%s%sDie alte Zuweisung entfernen und vergeben der Taste die neue Funktion%s%s zuordnen?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings."
msgstr "Das Anwendungspaket %s%sdas für die Ausführung nötig ist fehlt oder ist nicht ausführbar.%sWollen Sie es anlegen?%s%sDie Einstellungen finden Sie unter Projekt -> Projekteinstellungen -> Anwendung."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local"
msgstr "Das ausführende Programm %s%s%s%sist nicht vorhanden oder nicht ausführbar.%s%sSiehe Start -> Startparameter -> Lokal"

#: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr
msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files"
msgstr "Das Lazarusverzeichnis wurde nicht gefunden.%sSie können keine LCL-Anwendungen erzeugen.%sBitte prüfen Sie Einstellungen -> Umgebungseinstellungen -> Dateien"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually."
msgstr "Die LFM-Datei (Lazarus Form) enthält ungültige Eigenschaften. Das bedeutet beispielsweise, daß einige Eigenschaften/Klassen nicht in der aktuellen LCL enthalten sind. Das wird normalerweise behoben, indem diese Eigenschaften aus der LFM-Datei entfernt und der Pascal-Quelltext manuell korrigiert wird."

#: lazarusidestrconsts.listhenameisnotavalidpascalidentifier
msgid "The name %s%s%s is not a valid pascal identifier."
msgstr "Der Name %s%s%s ist kein gültiger Pascalbezeichner."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr ""

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Die neue Unit ist noch nicht im Unit-Suchpfad.%sVerzeichnis hinzufügen %s?"

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr ""

#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory %s%s%s is missing."
msgstr "Das Ausgabeverzeichnis %s%s%s fehlt."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Das Ausgabeverzeichnis von %s ist im Include-Pfad von %s aufgeführt."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Das Ausgabeverzeichnis von %s ist im abgeleiteten Include-Pfad von %s aufgeführt."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Das Ausgabeverzeichnis von %s ist im abgeleiteten Unit-Suchpfad von %s aufgeführt."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Das Ausgabeverzeichnis von %s ist im Unit-Suchpfad von %s aufgeführt."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "Das Ausgabeverzeichnis sollte ein eigenes Verzeichnis sein und keine Quelldateien enthalten."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Die Eigentümerklasse heißt"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Der Eigentümer heißt"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Das Package %s fügt den Pfad \"%s\" zum Include-Pfad der IDE hinzu.%sDies ist wahrscheinlich eine Fehlkonfiguration des Packages."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Das Package %s fügt den Pfad \"%s\" zum Unit-Pfad der IDE hinzu.%sDies ist wahrscheinlich eine Fehlkonfiguration des Packages."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Das Package enthält bereits eine Unit mit diesem Namen."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgstr "Das Package %s kann nicht deinstalliert werden, da es von der IDE selbst benötigt wird."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%s%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr ""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s"
msgstr "Das Programm %smake%s wurde nicht gefunden.%sEs wird für das Kompilieren von Lazarus benötigt.%s"

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, but it seems it needs it.%sYou will get strange linker errors if you use the LCL forms without interfaces."
msgstr "Das Projekt bindet die LCL-Unit-Schnittstelllen nicht ein, scheint sie aber zu brauchen.%sEs führt zu Linker-Fehlern, wenn die LCL-Fenster ohne ihre Interfaces eingebunden werden."

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Das Projekt hat keine Haupt-Quelldatei."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file %s%s%s%sis equal to the project main source file!"
msgstr "Die Projekt-Infodatei %s%s%s%sist identisch zur Haupt-Quelltextdatei des Projekts!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file %s%s%s%shas changed on disk."
msgstr "Die Projektinformationsdatei %s%s%s%sauf dem Datenträger hat sich geändert."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Das Projekt muß vor dem Kompilieren gesichert werden.%sWenn Sie das Testverzeichnis in den Umgebungseinstellungen setzen,%können Sie neue Projekte erzeugen und sofort kompilieren.%sProjekt speichern?"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Das Projekt nutzt die Ziele OS=%s und CPU=%s.%sDie system.ppu für dieses Ziel wurde nicht in den Binärverzeichnissen von FPC gefunden. %sStellen Sie sicher, daß fpc für diese Zielplattform richtig installiert ist und daß die fpc.cfg die richtigen Verzeichnisangaben enthält."

#: lazarusidestrconsts.listheprojectusesthenewfpcresourceswhichrequiresatlea
msgid "The project uses the new FPC resources, which requires at least FPC 2.4"
msgstr "Das Projekt verwendet die neuen FPC Ressourcen, welche wenigstens FPC 2.4 benötigen"

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Das Verzeichnis enthält andere Dateien mit demselben Namen,%sdie sich nur in der Schreibung unterscheiden:%s%s%sSoll diese gelöscht werden?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?"
msgstr "Es gibt eine Datei mit dem gleichen Namen und einer ähnlichen Endung auf dem Datenträger%sVorhandene Datei: %s%sNeue Datei: %s%s%sProblematische Datei löschen?"

#: lazarusidestrconsts.listhereisalreadyabuildmacrowiththename
msgid "There is already a build macro with the name %s%s%s."
msgstr "Es gibt bereits ein Erstellmakro mit dem Namen %s%s%s."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Es gibt bereits eine Komponente mit diesem Namen."

#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name %s%s%s"
msgstr "Es gibt schon ein Formular mit dem Namen %s%s%s"

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Es gibt bereits ein IDE-Makro mit dem Namen \"%s\""

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique."
msgstr "Es gibt bereits eine Unit mit dem Namen %s%s%s. Pascal-Bezeichner müssen einzigartig sein."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name"
msgstr "Es gibt schon eine Unit mit dem Namen %s%s%s im Projekt.%sBitte wählen Sie einen anderen Namen."

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Es muß wenigstens einen Erstellmodus geben."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm."
msgstr "Die Ressourcenklasse %s%s%s ist von %s%s%s abgeleitet. Vielleicht ist das ein Schreibfehler anstelle von TForm?"

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Beim Schreiben der gewählten Komponte %s trat ein Fehler auf:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Beim Konvertieren des binären Streams der gewählten Komponente %s trat ein Fehler auf:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Beim Kopieren des Komponentenstroms in die Zwischenablage trat ein Fehler auf:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component can not be deleted."
msgstr "Die Ursprungskomponente kann nicht gelöscht werden."

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Diese Einstellungen werden mit dem Projekt gespeichert."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Diese Units wurden gefunden:"

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt
msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)"
msgstr "Das Testverzeichnis wurde nicht gefunden:%s%s%s%s%s(siehe Umgebungseinstellungen)"

#: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming
msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving."
msgstr "Die Unit %s%s%s ist bereits vorhanden.%s»Übergehen« wird ein Umbenennen erzwingen,%s»Abbrechen« bricht das Speichern dieses Quelltext ab%und unterbindet das Speichern."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Die Unit gehört zum Package %s"

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Die Unit %s existiert doppelt im Unitpfad der %s:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Die Unit heißt"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?"
msgstr "Der Unitdateiname %s%s%s ist nicht in Kleinbuchstaben.%sDer Free-Pascal-Compiler sucht nicht nach allen Schreibweisen. Es wird empfohlen, Dateinamen in Kleinbuchstaben zu verwenden.%s%sDatei in Kleinbuchstaben umbenennen?"

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Die Unit %s wird von anderen Dateien benötigt.%sVerweise automatisch anpassen?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique."
msgstr "Die Unit selbst hat schon den Namen %s%s%s. Pascal-Bezeichner müssen einzigartig sein."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s"
msgstr "Der Unitsuchpfad von %s%s%s entält das Quellverzeichnis %s%s%s des Packages %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Das Arbeitsverzeichnis %s%s%s fehlt.%sBitte prüfen Sie das Arbeitsverzeichnis im Menü Start > Startparameter"

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Diese Funktion benötigt eine geöffnete .lfm Datei im Quelltexteditor."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "Diese Hilfeanzeige"

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Das sieht wie eine Pascal-Datei aus.%sEs wird empfohlen, Dateinamen in Kleinbuchstaben anzugeben um diverse Probleme auf einige Dateisystemen und mit verschiedenen Compilern aus dem Weg zu gehen.%sIn Kleinbuchstaben umbenennen?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Das Projekt hat keine Haupt-Quelldatei"

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory %s%s%s is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Diese Zusammenstellung von Optionen für das Kompilieren von Lazarus wird von dieser Installation nicht unterstützt.%sDas Verzeichnis %s%s%s ist nicht beschreibbar.%sSuchen Sie auf der Lazarus-Webseite nach anderen Möglichkeiten, Lazarus zu installieren."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Diese Anweisung kann nicht extrahiert werden.%sBitte wählen Sie etwas Code, um eine neue Prozedur/Methode zu extrahieren."

#: lazarusidestrconsts.listhiswillcreateacircle
msgid "This will create a circle."
msgstr ""

#: lazarusidestrconsts.listinfobuildautocloseonsuccess
msgid "&Automatically close on success"
msgstr "Bei Erfolg &automatisch schließen"

#: lazarusidestrconsts.listinfobuildcompiling
msgid "Compiling:"
msgstr "Kompiliere:"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titel"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Der Titel in der Taskbar zeigt z.B.: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titel (für Voreinstellung leerlassen)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Funktion: Pfadtrenner anhängen"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: chomp path delimiter"
msgstr "Funktion: Pfadtrenner entfernen"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Funktion: Dateiendung extrahieren"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Funktion: Dateinamen und Endung extrahieren"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Funktion: Dateinamen extrahieren"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Funktion: Dateipfad extrahieren"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(unbekanntes Makro: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Pfad:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Umschalten der Anzeige der Dateinamen zwischen voller/relativer Pfad"

#: lazarusidestrconsts.listoinstallyoumustcompileandrestarttheide
msgid "To install you must compile and restart the IDE"
msgstr "Zum Installieren müssen Sie die IDE kompilieren und neu starten"

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Oben"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Oben verankert"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Oberer Randabstand. Der Wert wird zum Grund-Randabstand addiert und für den Platz über dem Element verwendet."

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Obere Kanten"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgstr "Das ist das Geschwistercontrol, an das die Oberseite verankert wurde. Für den Parent leerlassen."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Gleichmäßiger oberer Rand"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Baum muß aktualisiert werden"

#: lazarusidestrconsts.listurbopascal
msgid "Turbo Pascal"
msgstr "Turbo Pascal"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr ""

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Diese Meldung nicht erneut anzeigen"

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Fehler im regulären Ausdruck"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Schriftart ohne UTF-8"

#: lazarusidestrconsts.lisuegotoline
#| msgid "Goto line :"
msgid "Goto line:"
msgstr "Springe zu Zeile:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nicht gefunden"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of %s%s%s%s with %s%s%s?"
msgstr "Dieses Vorkommen von %s%s%s%s mit %s%s%s ersetzen?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Suche: %s"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Suchbegriff »%s« nicht gefunden!"

#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options."
msgstr "Die aktuelle Editorschriftart unterstützt UTF-8 nicht, aber das System scheint das zu tun.%sDas bedeutet, daß Nicht-ASCII-Zeichen möglicherweise falsch angezeigt werden.%In den Editoreinstellungen sollten Sie eine andere Schriftart einstellen."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Include-Cache löschen"

#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s Byte"

#: lazarusidestrconsts.lisuidclear
msgid "Clear"
msgstr "Leeren"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Eingebunden von:"

#: lazarusidestrconsts.lisuidinproject
msgid "in Project:"
msgstr "im Projekt:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Zeilen:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Name:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "Nein"

#: lazarusidestrconsts.lisuidok
msgctxt "lazarusidestrconsts.lisuidok"
msgid "Ok"
msgstr "OK"

#: lazarusidestrconsts.lisuidpathsreadonly
msgid "Paths (Read Only)"
msgstr "Pfade (schreibgeschützt)"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Größe:"

#: lazarusidestrconsts.lisuidsrc
msgid "Src"
msgstr "Quelle"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Typ:"

#: lazarusidestrconsts.lisuidunit
msgctxt "lazarusidestrconsts.lisuidunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "Ja"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Anzeige der CodeTools-Werte"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Kann binären Datenstrom nicht in Text umwandeln"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Kann Komponente nicht in die Zwischenablage kopieren"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kann den den Ressoucen-Header-Kommentar nicht zu der Ressourcendatei %s%s%s%s hinzufügen.%sMöglicherweise ein Syntaxfehler."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error."
msgstr "Kann die Ressource T%s nicht einfügen:FORMDATA zur Ressourcendatei %s%s%s%s.%sMöglicherweise ein Syntaxfehler."

#: lazarusidestrconsts.lisunabletoaddsetting
msgid "Unable to add setting"
msgstr "Deinstallation unmöglich"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgstr "Kann %s nicht zum Projekt hinzufügen. Das Projekt enthält bereits eine Unit mit dem gleichen Namen."

#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file %s%s%s to %s%s%s!"
msgstr "Kann Datei %s%s%s nicht nach %s%s%s speichern!"

#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sKann die Klasse %s nicht nach %s ändern"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Kann Zielverzeichnis nicht aufräumen"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up %s%s%s.%sPlease check permissions."
msgstr "Kann %s%s%s nicht aufräumen.%sÜberprüfen Sie die Dateirechte."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Kann Komponententext nicht ins Binärformat umwandeln:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file %s%s%s%sError: %s"
msgstr "Kann Datei %s%s%snicht konvertieren%sFehler: %s"

#: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile
msgid "Unable to convert lfm to lrs and write lrs file."
msgstr "Kann lfm nicht in lrs konvertieren und lrs-Datei nicht schreiben."

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)"
msgstr "Kann die konvertierten Textformulardaten der Datei %s%s%s%s%snicht in einen Binärstream umwandeln. (%s)"

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Kann Datei nicht kopieren"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file %s%s%s%sto %s%s%s"
msgstr "Kann Datei %s%s%s%s nicht nach %s%s%s kopieren"

#: lazarusidestrconsts.lisunabletocopyfileto2
msgid "Unable to copy file %s%s%s%sto %s%s%s."
msgstr "Kann Datei %s%s%s%s nicht nach %s%s%s kopieren."

#: lazarusidestrconsts.lisunabletocreatebackupdirectory
msgid "Unable to create backup directory %s%s%s."
msgstr "Kann Backup-Verzeichnis %s%s%s nicht anlegen."

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory %s%s%s."
msgstr "Kann Verzeichnis %s%s%s nicht erzeugen."

#: lazarusidestrconsts.lisunabletocreatedirectory2
msgid "Unable to create directory %s%s%s"
msgstr "Kann Verzeichnis %s%s%s nicht erzeugen"

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Unfähig, die Datei anzulegen"

#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file %s%s%s"
msgstr "Kann Datei %s%s%s nicht erzeugen"

#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s%s%s%s"
msgstr "Kann Datei%s%s%s%s nicht anlegen"

#: lazarusidestrconsts.lisunabletocreatefilename
msgid "Unable to create file %s%s%s."
msgstr "Kann Datei %s%s%s nicht erzeugen."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link %s%s%s with target %s%s%s"
msgstr "Kann den Link %s%s%s zum Ziel %s%s%s nicht anlegen"

#: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin
msgid "Unable to create new method. Please fix the error shown in the message window."
msgstr "Kann die neue Methode nicht anlegen. Bitte beheben Sie den im Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Temporärer lfm-Puffer kann nicht erzeugt werden."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Kann nicht löschen"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file %s%s%s"
msgstr "Kann die unklare Datei %s%s%s nicht löschen"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Kann in dieser oder den anderen benutzten Units keinen ResourceString-Abschnitt finden"

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in %s%s%s"
msgstr "In %s%s%s ist kein gültiger Klassenname enthalten."

#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file %s%s%s."
msgstr "Datei %s%s%s kann nicht gefunden werden."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test"
msgstr "Kann die Datei %s%s%s nicht finden.%sFalls sie zum Projekt gehört, prüfen Sie den Suchpfad in der Startseite von%sProjekt->Compilereinstellungen ... unter Andere Unit-Dateien. Wenn die Datei zu einem Package gehört, müssen dessen Einstellungen geprüft werden. Falls die Datei zu Lazarus gehört, muß sichergestellt sein, daß die IDE sauber kompiliert ist. Gehört die Datei zu FPC muß die fpc.cfg überprüft werden. Bei Unklarheiten hilft der Button Test unter Projekt -> Compilereinstellungen ... -> Test"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Kann %s nicht im lfm-Stream finden."

#: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage
msgid "Unable to find method. Please fix the error shown in the message window."
msgstr "Kann die Methode nicht finden. Bitte beheben Sie den im Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find pascal unit (.pas,.pp) for .lfm file%s%s%s%s"
msgstr "Kann keine Pascal-Unit (.pas,.pp) finden für .lfm Datei%s%s%s%s"

#: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass
msgid "Unable to find the unit of component class %s%s%s."
msgstr "Kann die Unit der Komponentenklasse %s%s%s nicht finden."

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Kann Editoränderungen nicht sammeln."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Quelltexte des Designers können nicht geholt werden."

#: lazarusidestrconsts.lisunabletoloadfile
msgid "Unable to load file:%s%s"
msgstr "Kann Datei:%s%s nicht laden"

#: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis
msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error."
msgstr "Die alte Ressourcendatei kann nicht geladen werden.%sDie Ressourcendatei ist die erste Include-Datei im%sInitialisierungsabschnitt.%sZum Beispiel {$I %s.lrs}.%sMögliche Ursache ist ein Syntaxfehler."

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package %s%s%s"
msgstr "Fehler beim Laden von Package %s%s%s"

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class %s%s%s, because it depends on itself."
msgstr "Kann die Komponentenklasse %s%s%s nicht laden.Sie hängt von sich selbst ab."

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Kann Vorfahrkomponente nicht öffnen"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Designer kann nicht geöffnet werden.%sDie Klasse %s stammt nicht von einer designfähigen Klasse wie TForm oder TDataModule ab."

#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Kann %s nicht lesen"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Die Datei kann nicht gelesen werden"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file %s%s%s!"
msgstr "Die Datei %s%s%s kann nicht gelesen werden."

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file %s%s%s%sError: %s"
msgstr "Die Datei %s%s%s kann nicht gelesen werden.%sFehler: %s"

#: lazarusidestrconsts.lisunabletoreadfilename
msgid "Unable to read file %s%s%s."
msgstr "Die Datei %s%s%s kann nicht gelesen werden."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Kann Projekt-Infodatei%s%s%s%s nicht lesen."

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile2
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile2"
msgid "Unable to read the project info file%s%s%s%s."
msgstr "Kann Projekt-Infodatei%s%s%s%s nicht lesen."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file %s%s%s!"
msgstr "Die alte Sicherungsdatei %s%s%s kann nicht gelöscht werden."

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s"
msgstr "Kann die unklare Datei %s%s%s%snicht nach %s%s%s umbenennen."

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Kann die Datei nicht umbennen"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file %s%s%s to %s%s%s!"
msgstr "Die Datei %s%s%s kann nicht in %s%s%s umbenannt werden."

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file %s%s%s%sto %s%s%s."
msgstr "Die Datei %s%s%s%s kann nicht in %s%s%s umbenannt werden."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Kann Formular im Quelltext nicht umbenennen."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Die Methode kann nicht umbenannt werden. Beheben Sie bitte den im Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Die Variable im Quelltext kann nicht umbenannt werden."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Kann nicht starten"

#: lazarusidestrconsts.lisunabletosavefile
msgid "Unable to save file %s%s%s"
msgstr "Kann die Datei %s%s%s nicht speichern"

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Kann Ankerseiten-Kontrollelement nicht setzen"

#: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage
msgid "Unable to show method. Please fix the error shown in the message window."
msgstr "Kann Methode nicht anzeigen. Bitte beheben Sie den im Meldungsfenster gezeigten Fehler."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Kann die gewählten Komponenten nicht streamen"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Die ausgewählten Komponenten können nicht gestreamt werden."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Kann %s nicht streamen: T%s"

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Kann binären Komponentenstream von %s für T%s nicht in Text umwandeln."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Kann die CreateForm-Anweisung im Projektquelltext nicht aktualisieren"

#: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext
msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt."
msgstr "Kann die binäre Ressourcendatei%s%s%snicht aus der Textressource%s%s%s%saktualisieren. Wahrscheinlich ist die Textdatei defekt."

#: lazarusidestrconsts.lisunabletowrite
msgid "Unable to write %s%s%s%s%s."
msgstr "Kann Datei %s%s%s%s nicht schreiben%s."

#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write %s%s%s"
msgstr "Kann Datei %s%s%s nicht schreiben"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Kann die Datei nicht schreiben"

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file %s%s%s%sError: %s"
msgstr "Kann die Datei %s%s%snicht schreiben%sFehler: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s%s%s%s.%sError: %s"
msgstr "Kann die Projekt-Infodatei%s%s%s%snicht schreiben.%sFehler: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr ""

#: lazarusidestrconsts.lisunabletowritetofile
#, fuzzy
#| msgid "Unable to write to file %s%s%s!"
msgid "Unable to write to file %s%s%s."
msgstr "Kann die Datei %s%s%s nicht schreiben!"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr ""

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Kann XML-Stream nicht in %s%s schreiben. Fehler: %S"

#: lazarusidestrconsts.lisunexpectedresultthedebuggerwillterminate
msgid "Unexpected result:%sThe debugger will terminate"
msgstr "Unerwartetes Ergebnis:%s Der Debugger wird beendet"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Deinstallation unmöglich"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Auswahl deinstallieren"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit %s%s%s has changed. Save?"
msgstr "Unit %s%s%s wurde geändert. Speichern?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Unit-Bezeichner ist vorhanden"

#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s%s"
msgstr "%s Unit %s in Package %s%s"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Unit-Name ist bereits im Projekt vorhanden"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Der Unit-Name beginnt mit ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Der Unit-Name enthält ..."

#: lazarusidestrconsts.lisunitnotfound
#| msgid "Unit not found"
msgid "A unit not found in"
msgstr "Unit nicht gefunden in"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Unit-Ausgabeverzeichnis"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "Unit-Pfad"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Unit-Pfade"

#: lazarusidestrconsts.lisunitsnotfound2
#| msgid "Units not found"
msgid "Units not found in"
msgstr "Units nicht gefunden in"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr ""

#: lazarusidestrconsts.lisunusedunits
msgid "Unused units"
msgstr "Nicht verwendete Units"

#: lazarusidestrconsts.lisupdatepreview
msgid "Update preview"
msgstr "Vorschau aktualisieren"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Verweise aktualisieren?"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "Großbuchstabige Zeichenkette"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter"
msgstr "Großbuchstabige Zeichenkette als Parameter angegeben"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Ausgabe für den Aufruf (Parameter -h)"

#: lazarusidestrconsts.lisuse
msgid "Use..."
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgid "Use Ansistrings"
msgstr "Verwende Ansistrings"

#: lazarusidestrconsts.lisuseexcludefilter
msgid "Use Exclude Filter"
msgstr "Exclude-Filter anwenden"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Bezeichner verwenden"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Bezeichner %s in %s bei %s verwenden"

#: lazarusidestrconsts.lisuseincludefilter
msgid "Use Include Filter"
msgstr "Include-Filter anwenden"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Startprogramm"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Verwende Package %s in Ppackage %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Verwende Package in Package"

#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Verwende Package %s in Projekt"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Verwende Package in Projekt"

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Heimatverzeichnis des Users"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Verwende Unit %s in Unit %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 mit BOM"

#: lazarusidestrconsts.lisvalue
msgid "Value:"
msgstr "Wert:"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Wert%s"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Werte"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Methodenaufrufe prüfen"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Version"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Senkrecht"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Versionsinformationen in die Zwischenablage kopieren"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgid "View Breakpoint Properties"
msgstr "Haltepunkt-Eigenschaften anzeigen"

#: lazarusidestrconsts.lisviewprojectunits
msgid "View Project Units"
msgstr "Projektunits anzeigen"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Quelltext (.lfm) anzeigen"

#: lazarusidestrconsts.lisvsrforwardsearch
msgid "Forward Search"
msgstr "Vorwärts suchen"

#: lazarusidestrconsts.lisvsrresetresultlist
msgid "Reset Result List"
msgstr "Ergebnisliste zurücksetzen"

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s"
msgstr "Warnung: Unklarer Dateiname gefunden: %s%s%s. Quelldatei ist: %s%s%s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr ""

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "Über&wachen"

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Properties überwachen"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references ..."
msgstr "Wenn eine Unit umbenannt wird, Referenzen aktualisieren ..."

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgstr "Wenn eingeschaltet, werden die derzeit gewählten Optionen in ein Template für das Anlegen neuer Projekte gespeichert"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr ""

#: lazarusidestrconsts.liswithincludes
msgid "%s, with includes %s"
msgstr ""

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ""

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Mit benötigten Packages"

#: lazarusidestrconsts.liswladd
msgid "&Add"
msgstr "&Hinzufügen"

#: lazarusidestrconsts.liswldelete
msgid "&Delete"
msgstr "&Löschen"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Alle &Löschen"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Alle A&bschalten"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "Alle &einschalten"

#: lazarusidestrconsts.liswlenabled
msgid "&Enabled"
msgstr "&Einschalten"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Ausdruck"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Eigenschaften"

#: lazarusidestrconsts.liswlwatchlist
msgid "Watch list"
msgstr "Liste der überwachten Ausdrücke"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Wort an der aktuellen Cursorposition im Editor"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Arbeitsverzeichnis für das Kompilieren"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Arbeitsverzeichnis für den Start"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Schreibfehler"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Schreibfehler: %s%sDatei: %s%s%s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "XML-Fehler"

#: lazarusidestrconsts.lisxmlfiles
msgid "XML files"
msgstr "XML-Dateien"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "XML-Parserfehler in der Datei %s%sFehler: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Sie können dies deaktivieren für individuelle Formulare über das Kontextmenü im Projektinspektor."

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You can not build lazarus while debugging or compiling."
msgstr "Lazarus kann während des Debuggens oder Kompilierens nicht neu kompiliert werden."

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Quelltexteditor"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Package-Unit zum Uses-Abschnitt zufügen"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Umgekehrt zufügen"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Kompiliernummer automatisch erhöhen"

#: lazarusidestrconsts.rsavailablescanners
msgid "Available scanners"
msgstr "Verfügbare Scanner"

#: lazarusidestrconsts.rsbuild
#, fuzzy
#| msgid "Build:"
msgid "&Build:"
msgstr "Neu kompilieren:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Zeichensatz:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Aktuelle Seite schließen"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Compilerschalter"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Erzeugt neuen Schalter"

#: lazarusidestrconsts.rscreatingdirfailed
msgid "Creating directory \"%s\" failed!"
msgstr "Verzeichnis »%s« konnte nicht angelegt werden!"

#: lazarusidestrconsts.rscreatingsymlinkfailed
msgid "Creating symbolic link \"%s\" failed!"
msgstr "Symbolischer Link »%s« konnte nicht angelegt werden!"

#: lazarusidestrconsts.rscreatingsymlinknotsupported
msgid "Creating symbolic link is not supported on this platform!"
msgstr "Auf dieser Plattform gibt es keine symbolischen Links!"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "i18n einschalten"

#: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin
#, fuzzy
#| msgid "Enter one or more phrases that you want to Search or Filter in the list, seperated by space, or comma"
msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma"
msgstr "Geben Sie ein oder mehr Begriffe ein (mit Leerzeichen- oder Kommata getrennt), nach denen in der Liste gesucht oder nach denen gefiltert wird"

#: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression
msgid "Filter the list with the current filter expression"
msgstr "Filtern der Liste mit dem aktuellen Filterausdruck"

#: lazarusidestrconsts.rsformdatafiledfm
msgid "Form data file (*.dfm)|*.dfm"
msgstr "Form-Datendatei (*.dfm)|*.dfm"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found, but not listed here: "
msgstr "Gefunden aber hier nicht aufgeführt: "

#: lazarusidestrconsts.rsgotothenextiteminthesearchlist
msgid "Go to the next item in the search list"
msgstr "Zum nächsten Eintrag in der Suchliste gehen"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "i18n-Einstellungen"

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include Version Info in executable"
msgstr "Versionsinfo in ausführbare Datei einfügen"

#: lazarusidestrconsts.rsiwpcustomposition
msgid "Custom position"
msgstr "Benutzerdefinierte Position"

#: lazarusidestrconsts.rsiwpdefault
msgctxt "lazarusidestrconsts.rsiwpdefault"
msgid "Default"
msgstr "Voreinstellung"

#: lazarusidestrconsts.rsiwpdocked
msgid "Docked"
msgstr "Angedockt"

#: lazarusidestrconsts.rsiwprestorewindowgeometry
msgid "Restore window geometry"
msgstr "Fensterwerte wiederherstellen"

#: lazarusidestrconsts.rsiwprestorewindowsize
msgid "Restore window size"
msgstr "Fenstergröße wiederherstellen"

#: lazarusidestrconsts.rsiwpusewindowmanagersetting
msgid "Use windowmanager setting"
msgstr "Angabe des Windowmanagers verwenden"

#: lazarusidestrconsts.rskey
msgctxt "lazarusidestrconsts.rskey"
msgid "Key"
msgstr "Taste"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arabisch"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or english)"
msgstr "Automatisch (oder Englisch)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Katalanisch"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinesisch"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Tschechisch"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Niederländisch"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Englisch"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finnisch"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Französisch"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Deutsch"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebräisch"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonesisch"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italienisch"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japanisch"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litauisch"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Spracheinstellungen"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polnisch"

#: lazarusidestrconsts.rslanguageportugues
msgid "Portuguese"
msgstr "Portugisisch"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russisch"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Sprachauswahl:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovakisch"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Spanisch"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Türkisch"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrainisch"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Hauptversion:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "U&nterversion:"

#: lazarusidestrconsts.rsok
msgid "ok"
msgstr "ok"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Andere Info"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "PO-Ausgabeverzeichnis:"

#: lazarusidestrconsts.rsremove
msgid "&Remove"
msgstr "&Löschen"

#: lazarusidestrconsts.rsresetfilter
msgid "Reset filter"
msgstr "Filter zurücksetzen"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revision"

#: lazarusidestrconsts.rsscanners
msgid "Scanners"
msgstr "Scanner"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Abgeleiteten Eintrag auswählen"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Neue Suche beginnen"

#: lazarusidestrconsts.rsvalue
msgctxt "lazarusidestrconsts.rsvalue"
msgid "Value"
msgstr "Wert"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Versionszählung"

#: lazarusidestrconsts.srkmalreadyconnected
msgid " The key \"%s\" is already connected to \"%s\"."
msgstr " Der Taste »%s« ist bereits »%s« zugewiesen."

#: lazarusidestrconsts.srkmalternkey
msgid "Alternative key (or 2 keys combination)"
msgstr "Alternative Taste (oder 2-Tastenkombination)"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Befehle aus dem Menü 'Hilfe'"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Kommandoanweisungen"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeTools-Befehle"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Textspaltenauswahlbefehle"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Befehle für die Cursorsteuerung"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Texteditorbefehle"

#: lazarusidestrconsts.srkmcatenvmenu
msgid "Environment menu commands"
msgstr "Umgebungsmenü-Befehle"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Befehle aus dem Menü 'Datei'"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Textfaltungs-Befehle"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text marker commands"
msgstr "Textmarkierungsbefehle"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Befehle aus dem Menü 'Package'"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Befehle aus dem Menü 'Projekt'"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Befehle aus dem Menü 'Start'"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Befehle für Textsuche und -änderung"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Textauswahlbefehle"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Editorbefehle"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Synchronbearbeitung"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Synchronbearbeitung (nicht in Zelle)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Synchronbearbeitung (bei der Auswahl)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Vorlagenbearbeitung"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Vorlagenbearbeitung (nicht in Zelle)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Befehle aus dem Menü 'Werkzeuge'"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Befehle aus dem Menü 'Ansicht'"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Befehl:"

#: lazarusidestrconsts.srkmcommand1
msgid "    command1 \""
msgstr "   Befehl1 »"

#: lazarusidestrconsts.srkmcommand2
msgid "    command2 \""
msgstr "   Befehl2 »"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Konflikt"

#: lazarusidestrconsts.srkmconflicw
msgid " conflicts with "
msgstr " steht im Konflikt mit "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Kompiliervorgang abbrechen"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add jump point"
msgstr "Neue Sprungmarke"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Neuer überwachter Ausdruck"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Quelltextvervollständigung per Vorlage"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Block kopieren"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Block löschen"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Zum Blockanfang"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Zum Blockende"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Block verbergen"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Block einrücken"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Block verschieben"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Blockanfang festlegen"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Blockende festlegen"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Block zeigen"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Block umschalten"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Block ausrücken"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Programm/Projekt kompilieren"

#: lazarusidestrconsts.srkmecbuildall
msgid "build all files of program/project"
msgstr "Alle Dateien des Programms/Projekts kompilieren"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Datei kompilieren"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build lazarus"
msgstr "Lazarus neu kompilieren"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Zeichen"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Gesamten Text löschen"

#: lazarusidestrconsts.srkmeccodetoolsdefinesed
msgid "Codetools defines editor"
msgstr "Editor für CodeTools-Einstellungen"

#: lazarusidestrconsts.srkmeccodetoolsoptions
msgid "Codetools options"
msgstr "CodeTools-Einstellungen"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Spalte nach unten wählen"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Spalte bis zum absoluten Ende wählen"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Spalte bis zum absoluten Anfang wählen"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Spalte links wählen"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Spalte bis zum Zeilenende wählen"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Spalte bis zum Zeilenbeginn wählen"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Spalte bis zum Textanfang auf der Zeile wählen"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Spalte bis zum Seitenende wählen"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Spalte seitenweise nach unten wählen"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Spalte bis zum Seitenanfang wählen"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Spalte seitenweise nach oben wählen"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Spalte rechts wählen"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Spalte hoch wählen"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Spalte Wort links wählen"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Spalte Wort rechts wählen"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Spaltenauswahlmodus"

#: lazarusidestrconsts.srkmeccompileroptions
msgid "compiler options"
msgstr "Compilereinstellungen"

#: lazarusidestrconsts.srkmeccompletecode
msgid "Complete code"
msgstr "Quelltext vervollständigen"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "Konfiguriere Kompilierungsdatei"

#: lazarusidestrconsts.srkmeccopy
msgid "Copy selection to clipboard"
msgstr "Auswahl in die Zwischenablage kopieren"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Editor in neues Fenster kopieren"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Editor in nächstes freies Fenster kopieren"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Editor in vorheriges freies Fenster kopieren"

#: lazarusidestrconsts.srkmeccustomtool
msgid "Custom tool %d"
msgstr "Benutzerdefiniertes Werkzeug %d"

#: lazarusidestrconsts.srkmeccut
msgid "Cut selection to clipboard"
msgstr "Auswahl in die Zwischenablage ausschneiden"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Bis zum Zeilenanfang löschen"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Zeichen unter Cursor löschen"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Bis zum Zeilenende löschen"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Letztes Zeichen löschen"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Bis zum Wortanfang löschen"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Lösche aktuelle Zeile"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Bis zum Wortende löschen"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Dateivergleich"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Cursor ans absolute Ende bewegen"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Cursor an den absoluten Anfang bewegen"

#: lazarusidestrconsts.srkmecenvironmentoptions
#, fuzzy
#| msgid "General environment options"
msgid "IDE options"
msgstr "Allgemeine Umgebungseinstellungen"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "auswerten/ändern"

#: lazarusidestrconsts.srkmecextractproc
msgid "Extract procedure"
msgstr "Prozedur extrahieren"

#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Externes Werkzeug %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Einstellungen für externe Werkzeuge"

#: lazarusidestrconsts.srkmecfind
msgid "Find text"
msgstr "Text suchen"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Anderes Blockende suchen"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Blockanfang suchen"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find declaration"
msgstr "Deklaration suchen"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find identifier references"
msgstr "Bezeichnerreferenzen suchen"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in files"
msgstr "In Dateien suchen"

#: lazarusidestrconsts.srkmecfindnext
msgid "Find next"
msgstr "Nächstes suchen"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find next word occurrence"
msgstr "Nächste Fundstelle des Worts"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find overloads"
msgstr "Überladungen suchen"

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find previous"
msgstr "Vorheriges suchen"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find previous word occurrence"
msgstr "Vorhergehende Fundstelle des Worts"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find procedure definiton"
msgstr "Prozedurdefinition suchen"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find procedure method"
msgstr "Prozedur-Methode suchen"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Beim Cursor falten"

#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Falten auf Ebene %d"

#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Zu Editorfenster %d gehen"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to to include directive of current include file"
msgstr "Zur Include-Anweisung der aktuellen Include-Datei springen"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to line number"
msgstr "Zu Zeile springen"

#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to Marker %d"
msgstr "Zu Markierung %d gehen"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Zu Position springen"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess misplaced $IFDEF"
msgstr "Falsch gesetzte $IFDEF raten"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime-String"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Eintrag für Änderungsprotokoll einfügen"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Aus der Zeichentabelle einfügen"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "CVS-Schlüsselwort »Author« einfügen"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "CVS-Schlüsselwort »Date« einfügen"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "CVS-Schlüsselwort für den Header einfügen"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "CVS-Schlüsselwort für die ID einfügen"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "CVS-Schlüsselwort für das Protokoll  einfügen"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "CVS-Schlüsselwort für »Name« einfügen"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "CVS-Schlüsselwort für die Revision einfügen"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "CVS-Schlüsselwort für die Quelle einfügen"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Aktuelles Datum und Uhrzeit einfügen"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "GPL-Hinweis einfügen"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "GUID einfügen"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL-Hinweis einfügen"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Zeilen trennen, Cursor belassen"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Einfügemodus"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Hinweis zur modifizierten LGPL einfügen"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Aktuellen Usernamen eintragen"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "Inspizieren"

#: lazarusidestrconsts.srkmecinvertassignment
msgid "Invert assignment"
msgstr "Umgekehrte Zuweisung"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Zeilen trennen und Cursor bewegen"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Cursor zum Zeilenende bewegen"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Zeilenauswahlmodus"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Cursor zum Zeilenanfang bewegen"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Cursor an den Beginn des Texts in der Zeile setzen"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Sperr-Editor"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make resource string"
msgstr "Ressourcenstring erzeugen"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Zur korrespondierenden Klammer springen"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Editor nach links bewegen"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Editor ganz nach links verschieben"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Editor in neues Fenster kopieren"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Editor in nächstes freies Fenster kopieren"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Editor in vorheriges freies Fenster kopieren"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Editor nach rechts bewegen"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Editor ganz nach rechts verschieben"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Nächstes Lesezeichen"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Zu nächstem Editorfenster wechseln"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Zum nächsten Editor mit dem selben Quelltext"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Zum nächsten Fenster"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normaler Auswahlmodus"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open file at cursor"
msgstr "Datei am Cursor öffnen"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Überschreibe-Modus"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Cursor zum Seitenende bewegen"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Bewege Cursor eine Seite nach unten"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Bewege Cursor eine Seite nach links"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Bewege Cursor eine Seite nach rechts"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Cursor zum Seitenanfang bewegen"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Cursor eine Seite nach oben bewegen"

#: lazarusidestrconsts.srkmecpaste
msgid "Paste clipboard to current position"
msgstr "Einfügen der Zwischenablage an die aktuelle Stelle"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "Programmpause"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Vorheriges Lesezeichen setzen"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Zu vorigem Editorfenster wechseln"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Zum vorherigen Editor mit dem selben Quelltext"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Zum vorherigen Fenster"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Schnelles Kompilieren, kein Linken"

#: lazarusidestrconsts.srkmecquit
msgid "Quit"
msgstr "Schliessen"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove break point"
msgstr "Haltepunkt entfernen"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove empty methods"
msgstr "Leere Methoden entfernen"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove unused units"
msgstr "Ungenutzte Units entfernen"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename identifier"
msgstr "Bezeichner umbenennen"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace text"
msgstr "Ersetze Text"

#: lazarusidestrconsts.srkmecreportingbug
msgid "Reporting a bug"
msgstr "Fehler melden"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "Debugger zurücksetzen"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Programm starten"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "Datei starten"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "Startparameter"

#: lazarusidestrconsts.srkmecsave
msgctxt "lazarusidestrconsts.srkmecsave"
msgid "Save"
msgstr "Speichern"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Eine Zeile nach unten scrollen"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Ein Zeichen nach links scrollen"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Ein Zeichen nach rechts scrollen"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Eine Zeile nach oben scrollen"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Zeile unten auswählen"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Alles auswählen"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Umwandeln von Tabulatoren in Leerzeichen im Auswahlbereich"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Auswahl bis zum absoluten Ende"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Auswahl bis zum absoluten Anfang"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Bis zu Position auswählen"

#: lazarusidestrconsts.srkmecselleft
msgid "SelLeft"
msgstr "Zeichen links auswählen"

#: lazarusidestrconsts.srkmecsellineend
msgid "Select Line End"
msgstr "Zeilenende auswählen"

#: lazarusidestrconsts.srkmecsellinestart
msgid "Select Line Start"
msgstr "Zeilenanfang auswählen"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Bis zum Textbeginn in der Zeile auswählen"

#: lazarusidestrconsts.srkmecselpagebottom
msgid "Select Page Bottom"
msgstr "Bis zu Seitenende auswählen"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Auswahl Seite nach unten"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Auswahl Seite links"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Auswahl Seite rechts"

#: lazarusidestrconsts.srkmecselpagetop
msgid "Select Page Top"
msgstr "Auswahl Seitenanfang"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Auswahl Seite hoch"

#: lazarusidestrconsts.srkmecselright
msgid "SelRight"
msgstr "Zeichen rechts auswählen"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Auswahl nach oben"

#: lazarusidestrconsts.srkmecselwordleft
msgid "Select Word Left"
msgstr "Wort links auswählen"

#: lazarusidestrconsts.srkmecselwordright
msgid "Select Word Right"
msgstr "Wort rechts auswählen"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Freies Lesezeichen setzen"

#: lazarusidestrconsts.srkmecsetmarker
msgid "Set Marker %d"
msgstr "Markierung %d setzen"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Umsch-Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show abstract methods"
msgstr "Abstrakte Methoden anzeigen"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show code context"
msgstr "Code-Context anzeigen"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "Ausführungspunkt anzeigen"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "Programm anhalten"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Zur letzten Stelle in  der Zelle"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Zur ersten Stelle in der Zelle"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Zelle wählen"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Abbrechen"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Nächste Zelle"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Nächste Zelle (alle ausgewählt)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Vorherige Zelle"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Vorherige Zelle (alle ausgewählt)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Synchonbearbeitung beginnen"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Zur letzten Stelle in der Zelle"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Zur ersten Stelle in der Zelle"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Zelle wählen"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Abbrechen"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Beenden"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Nächste Zelle"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Nächste Zelle (rotiert)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Nächste Zelle (alle gewählt)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Nächste Zelle (rotiert/alle gewählt)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Vorherige Zelle"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Vorherige Zelle (alle gewählt)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax check"
msgstr "Syntaxüberprüfung"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Assembler anzeigen"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle break point"
msgstr "Haltepunkt umschalten"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Haltepunkte anzeigen"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Aufruf-Stacks anzeigen"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Code Browser anzeigen"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "CodeExplorer anzeigen"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Komponentenpalette anzeigen"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Debuggerausgabe anzeigen"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Zwischen Formular und Unit umschalten"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Dokumentationseditor anzeigen"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Speedbuttons der IDE anzeigen"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Lokale Variablen anzeigen"

#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle Marker %d"
msgstr "Marker %d umschalten"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Aktuelles Wort hervorheben (ein/aus)"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Meldungen anzeigen"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Modus wechseln"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Objektinspektor anzeigen"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Register anzeigen"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Browser für bedingte Eigenschaften anzeigen"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Suchergebnisse anzeigen"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Quelltexteditor anzeigen"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Überwachte Ausdrücke anzeigen"

#: lazarusidestrconsts.srkmecunfoldall
msgid "Unfold all"
msgstr "Alle entfalten"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Beim Cursor entfalten"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "unbekannter Editorbefehl"

#: lazarusidestrconsts.srkmecuserfirst
msgid "User First"
msgstr "Benutzer zuerst"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Ankereditor anzeigen"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Komponenten anzeigen"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Formulare anzeigen"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Unit-Abhängigkeiten anzeigen"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Unit-Informationen anzeigen"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Units anzeigen"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word completion"
msgstr "Wortvervollständigung"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Cursor ein Wort nach links bewegen"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Cursor ein Wort nach rechts bewegen"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Taste für Befehl bearbeiten"

#: lazarusidestrconsts.srkmeditkeys
msgid "Edit Keys"
msgstr "Editiertasten"

#: lazarusidestrconsts.srkmgrabkey
msgid "Grab key"
msgstr "Taste fangen"

#: lazarusidestrconsts.srkmgrabsecondkey
msgid "Grab second key"
msgstr "Zweite Taste fangen"

#: lazarusidestrconsts.srkmkey
msgid "Key (or 2 keys combination)"
msgstr "Taste (oder 2-Tasten-Kombination)"

#: lazarusidestrconsts.srkmpresskey
msgid "Please press a key ..."
msgstr "Beliebige Taste drücken ..."

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Kommentare in Auswahl falten"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Kommentare in Auswahl verbergen"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in Selection"
msgstr "Alles in Auswahl entfalten"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in Selection"
msgstr "Kommentare in Auswahl entfalten"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Datei ist nur lesbar"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Die Datei »"

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "« ist schreibgeschützt."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Gesperrt"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Überwachung an Cursorpos. &hinzufügen"

#: lazarusidestrconsts.uembookmarkn
msgid "Bookmark"
msgstr "Lesezeichen"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Alle anderen Seiten schließen"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "Seite s&chließen"

#: lazarusidestrconsts.uemcompletecode
msgctxt "lazarusidestrconsts.uemcompletecode"
msgid "Complete Code"
msgstr "Quelltext vervollständigen"

#: lazarusidestrconsts.uemcopy
msgctxt "lazarusidestrconsts.uemcopy"
msgid "Copy"
msgstr "Kopieren"

#: lazarusidestrconsts.uemcopyfilename
#, fuzzy
#| msgid "Copy filename"
msgid "Copy Filename"
msgstr "Dateiname kopieren"

#: lazarusidestrconsts.uemcopytonewwindow
#, fuzzy
#| msgid "Copy to new Window"
msgid "Clone to new Window"
msgstr "In neues Fenster kopieren"

#: lazarusidestrconsts.uemcopytootherwindow
#, fuzzy
#| msgid "Copy to other Window"
msgid "Clone to other Window"
msgstr "In anderes Fenster kopieren"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Neues Fenster"

#: lazarusidestrconsts.uemcut
msgctxt "lazarusidestrconsts.uemcut"
msgid "Cut"
msgstr "Ausschneiden"

#: lazarusidestrconsts.uemdebugword
msgid "Debug"
msgstr "Debug"

#: lazarusidestrconsts.uemeditorproperties
msgid "Editor properties"
msgstr "Editoreigenschaften"

#: lazarusidestrconsts.uemencloseselection
msgctxt "lazarusidestrconsts.uemencloseselection"
msgid "Enclose Selection"
msgstr "Auswahl einschließen"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Zeichenkodierung"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify..."
msgstr "Üb&erprüfen/Ändern"

#: lazarusidestrconsts.uemextractproc
msgctxt "lazarusidestrconsts.uemextractproc"
msgid "Extract Procedure"
msgstr "Prozedur extrahieren"

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Suche Deklaration"

#: lazarusidestrconsts.uemfindidentifierreferences
msgid "Find Identifier References"
msgstr "Bezeichnerreferenzen suchen"

#: lazarusidestrconsts.uemgotobookmark
msgctxt "lazarusidestrconsts.uemgotobookmark"
msgid "&Goto Bookmark"
msgstr "&Gehe zum Lesezeichen"

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Highlighter"

#: lazarusidestrconsts.ueminspect
msgid "&Inspect..."
msgstr "Prüfen..."

#: lazarusidestrconsts.ueminvertassignment
msgid "Invert Assignment"
msgstr "Umgekehrte Zuweisung"

#: lazarusidestrconsts.uemlineending
msgid "Line ending"
msgstr "Zeilenende"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "Seite sperren"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move page left"
msgstr "nach links"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move page leftmost"
msgstr "nach ganz links"

#: lazarusidestrconsts.uemmovepageright
msgid "Move page right"
msgstr "nach rechts"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move page rightmost"
msgstr "nach ganz rechts"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to new Window"
msgstr "In neues Fenster verschieben"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to other Window"
msgstr "In anderes Fenster verschieben"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Neues Fenster"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto next Bookmark"
msgstr "Springe zum nächsten Lesezeichen"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Geändert"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open file at cursor"
msgstr "Öffne &Datei beim Cursor"

#: lazarusidestrconsts.uempaste
msgctxt "lazarusidestrconsts.uempaste"
msgid "Paste"
msgstr "Einfügen"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto previous Bookmark"
msgstr "Springe zum vorigen Lesezeichen"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Prozedursprung"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Schreibgeschützt"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts.uemrenameidentifier
msgid "Rename Identifier"
msgstr "Bezeichner umbenennen"

#: lazarusidestrconsts.uemruntocursor
msgid "&Run to Cursor"
msgstr "Sta&rt bis zum Cursor"

#: lazarusidestrconsts.uemsetbookmark
msgid "&Set Bookmark"
msgstr "&Setze Lesezeichen"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Freies Lesezeichen setzen"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Zeilennummern einblenden"

#: lazarusidestrconsts.uemshowunitinfo
msgid "Unit Info"
msgstr "Unit-Information"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "Lese&zeichen umschalten"

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "&Toggle Breakpoint"
msgstr "Haltepunkt umschal&ten"

#: lazarusidestrconsts.uemviewcallstack
msgid "View Call Stack"
msgstr "Aufrufstack anzeigen"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Noch nicht implementiert"

#: lazarusidestrconsts.uenotimplcapagain
msgid "I told You: Not implemented yet"
msgstr "Ich habe es schon gesagt: Noch nicht implementiert"

#: lazarusidestrconsts.uenotimpltext
msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com"
msgstr "Wenn Sie uns helfen können, diese Funktion zu implementieren, senden Sie ein E-Mail an lazarus@miraclec.com"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "Einfg"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "Üb"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Schreibgeschützt"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Versionsinformation"