/usr/share/librg-utils-perl/blastpgp_to_saf.pl is in librg-utils-perl 1.0.43-4.
This file is owned by root:root, with mode 0o755.
The actual contents of the file can be viewed below.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 | #!/usr/bin/perl -w
use Carp qw| cluck :DEFAULT |;
use Data::Dumper qw||;
use List::MoreUtils;
our $debug;
if ($#ARGV < 0) { print "*** ERROR blastpgp_to_saf.pl : no arguments given\n"; print FHERROR "*** ERROR blastpgp_to_saf.pl : no arguments given\n"; die; }
foreach $arg (@ARGV){
if ($arg=~/^fileInBlast=(.*)$/) { $fileInBlast = $1;}
elsif ($arg=~/^fileInQuery=(.*)$/) { $fileInQuery = $1;}
elsif ($arg=~/^fileOutSaf=(.*)$/) { $fileOutSaf = $1;}
elsif ($arg=~/^fileOutRdb=(.*)$/) { $fileOutRdb = $1;}
elsif ($arg=~/^fileOutErr=(.*)$/) { $fileOutErr = $1;}
elsif ($arg=~/^red=(.*)$/) { $filterThre = $1;}
elsif ($arg=~/^maxAli=(.*)$/) { $maxAli = $1;}
elsif ($arg=~/^tile=(.*)$/) { $alignTiling = $1;}
elsif ($arg=~/^debug=(.*)$/) { $debug = $1;}
else {
print FHERROR "*** wrong command line arg '$arg'\n";
die;
}
}
if ($#ARGV < 0) { print "*** ERROR blastpgp_to_saf.pl : no arguments given\n";
print FHERROR "*** ERROR blastpgp_to_saf.pl : no arguments given\n"; die; }
#if (! defined $fileOutErr) {
# print "*** ERROR blastpgp_to_saf : fileOutErr output filename is not definded\n";
# die;}
if( defined( $fileOutErr ) )
{
open(FHERROR,">", $fileOutErr) || die "*** ERROR could not open error log file=$fileOutErr for writing";
}
else
{
open( FHERROR, '>&', \*STDERR ) || die( "$!" );
}
$inicheck=0;
if (! defined $fileInBlast) {
print FHERROR "*** ERROR blastpgp_to_saf : blast input file name is not defined\n";
$inicheck++;}
else { if (! -e $fileInBlast){
print FHERROR "*** ERROR blastpgp_to_saf : no input blast file $fileInBlast found\n";
$inicheck++;} }
if (! defined $fileInQuery) {
print FHERROR "*** ERROR blastpgp_to_saf : query input file name is not defined\n";
$inicheck++;}
else{ if(! -e $fileInQuery) {
print FHERROR "*** ERROR blastpgp_to_saf : no input query file $fileInQuery found\n";
$inicheck++;} }
if (! defined $fileOutSaf) {
print FHERROR "*** ERROR blastpgp_to_saf : SAF output filename is not definded\n";
$inicheck++;}
if (! defined $fileOutRdb) {
print FHERROR "*** ERROR blastpgp_to_saf : blastRdb output filename is not definded\n";
$inicheck++;}
if (! defined $filterThre) {
print FHERROR "*** ERROR blastpgp_to_saf : filter threshold is not definded\n";
$inicheck++;}
if (! defined $maxAli) {
print FHERROR "*** ERROR blastpgp_to_saf : maximum number of aligned sequences to be included in saf output file is not definded\n";
$inicheck++;}
if (! defined $alignTiling) {
print FHERROR "*** ERROR blastpgp_to_saf : tiling method of Blast alignment is not definded\n";
$inicheck++;}
die if ($inicheck != 0);
($Lok,$msg)= &blastp_to_saf($fileInBlast,$fileInQuery,$fileOutSaf,$fileOutRdb,$filterThre,$maxAli,$alignTiling);
if (! $Lok ) { print FHERROR "*** ERROR blastpgp_to_saf.pl : $msg\n"; die;}
if ($Lok == 2 ) { if( $debug ){ print FHERROR "*** WARNING blastpgp_to_saf.pl : $msg\n"; } exit(0); }
exit(0);
#=============================================================================================
sub blastp_to_saf {
my ($Lok,$msg);
my $sbr="blastp_to_saf"; #
local ($blastfile,$queryfile,$fileout,$rdb,$filter,$maxAli,$tile)=@_; #
local (@query, %sequences,@alignedids,@namesSort,%rdb_lines); #
local (@tmp_seq,@inserted_query,@seq,@alignedNames ); #
local ($key,$first,$last,$fhin,$local_counter,$beg,$index,$iter,$Score_count);
$fhin= "FHIN"; #
#------------------- gets the query sequence and its length
undef @query; #
open($fhin,$queryfile) || return(0,"*** ERROR sbr: could not open $queryfile - no such file");
$queryName='query'; #
while(<$fhin>){
next if( $_=~/^\n/ || $_=~/\// || $_=~/>/ || $_=~/#/ );
$_=~s/\s+//g;
@tmp=split(//,$_);
push @query, @tmp;
}
close $fhin;
$queryLength=$#query+1;
#..........................................................
if ( $rdb ne '0' && $rdb ne '' ){
$rdbFile=$rdb;
($Lok,$msg)= &printRdbHeader();
if (! $Lok){ return(0,"*** ERROR $sbr : $msg"); }
}
#------------------- finds number of iterations in blast file
my $blastplus_flag = 0;
open($fhin,$blastfile) || return(0,"*** ERROR $sbr: failed to open blast file $blastfile\n");
$iter=0; $nohits=0;
while(<$fhin>){
# BLASTP 2.2.18 [Mar-02-2008]
# PSIBLAST 2.2.25+
if($_=~/^\w+\s+\d+\.\d+\.\d+\+/o){ $blastplus_flag = 1; }
if($_=~/No hits found/){$nohits=1; last;}
if( !$blastplus_flag && $_=~/^Searching../o ){ $iter++; }
if( $blastplus_flag && $_=~/Results from round/o ){ $iter++; }
}
close $fhin;
if ($nohits eq '1'){
$sequences{''}=''; $alignedNames='';
($Lok,$msg)=&print_saf_file($queryName,$queryLength,\%sequences,\@alignedNames,@query);
return(0,"*** ERROR $sbr : $msg") if (! $Lok );
return(2,"*** WARNING $sbr : no hits found in Blastpgp search ");
}
return(0,"*** ERROR $sbr: blast file format not recognized") if ($iter == 0);
#............................................................
#--------------------------------skips to the last iteration
open($fhin,$blastfile) || return(0,"*** ERROR $sbr: failed to open blast file $blastfile\n");
$local_counter=0;
while(<$fhin>){
if( !$blastplus_flag && $_=~/^Searching../o ){ $local_counter++; }
if( $blastplus_flag && $_=~/Results from round/o ){ $local_counter++; }
last if($local_counter == $iter);
}
#............................................................
my $bug_query = 0;
undef @alignedNames; undef @alignedids; $Score_count=0; undef %multi_aligned; $global_count=0; undef %rdb_lines;
#@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@
#@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@
# lkajan: processing of a record is done when the beginning of the /following/ record is reached.
# lkajan: the last record therefore is processed when we reach the end of the input file - we do not rely on the
# lkajan: Number of Hits line any more - this allows truncated blast input (some user in Yanay's lab has such)
while(1)
{
my $bline = <$fhin>;
if( !$bline || $bline=~/^>/o )
{
if($global_count > 0){
undef %u_endings;
@seq=@{ $multi_aligned{'1'} };
if($tile ne "0" && $Score_count > 1){
$u_endings{'1'}[0]=$endings{'1'}[0]; $u_endings{'1'}[1]=$endings{'1'}[1];
foreach $itnum (2 .. $Score_count){
@temp=@{ $multi_aligned{$itnum} };
$iffy=1;
foreach $it ( 1 .. ($itnum-1)){
if (defined $u_endings{$it}){
if ($endings{$itnum}[0] >= $u_endings{$it}[0] && $endings{$itnum}[0] <= $u_endings{$it}[1] ){ $iffy=0;last;}
if ($endings{$itnum}[1] >= $u_endings{$it}[0] && $endings{$itnum}[1] <= $u_endings{$it}[1] ){ $iffy=0;last;}
}
}
if ($iffy==1){
$u_endings{$itnum}[0]=$endings{$itnum}[0]; $u_endings{$itnum}[1]=$endings{$itnum}[1];
$one=$u_endings{$itnum}[0]; $two=$u_endings{$itnum}[1];
@seq[$one .. $two]=@temp[$one .. $two];
}
else{delete $rdb_lines{$id}{$itnum}; }
}
}
foreach $elem (@seq){
if(($elem ne ".") && ($elem !~ /[a-z_A-Z]/)){
$elem=".";
}
}
$sequences{$id}=[ @seq ];
}
$global_count++;
undef @seq; $Score_count=0; undef %multi_aligned; undef %endings;
undef %u_endings;
#--- getting name of aligned sequence
for($it=0;$it<=$queryLength-1;$it++){ $seq[$it]="."; } #initialising array seq
if( $bline )
{
# lkajan: PE, SV may be on the > line when it is shorter
# blast:
#>sp|Q9TUI5|MT4_CANFA Metallothionein-4 OS=Canis familiaris GN=MT4
# PE=3 SV=1
# Length = 62
# blast+:
#> sp|Q9TUI5|MT4_CANFA Metallothionein-4 OS=Canis familiaris GN=MT4
#PE=3 SV=1
#Length=62
if( not $bline=~s/^> *//o ){ confess("unrecognized line '$bline'"); }
$id=$bline; if( not $id=~s/^(\S*)\s+(.*)\s*$/$1/o ){ confess("failed to extract id from '$id'"); }
$protDspt=$2; chomp $protDspt;
push @alignedids, $id;
}
else { last; }
} #------------------------------------
if ($bline=~/^ Score/o){
$Score_count++;
for($it=0;$it<=$queryLength-1;$it++){ $block_seq[$it]="."; }
undef @ali_para;
}
next if ( $Score_count > 1 && $tile==0 );
#-----------------------------------------------------------------------------------------------------
if ( $rdb ne '0' && $rdb ne ''){
#
if ( $bline=~ /\s*Length/){ $len2=$bline;if( $len2 !~ /Length\s*=\s*([0-9]+)/o ){ confess( "unrecognized length '$len2'"); } $len2 = $1; }
# lkajan: whitespaces vary between blast and blast+
# Score = 84.3 bits (207), Expect = 2e-15, Method: Compositional matrix adjust.
if ( $bline=~ /Score/ ){
$lali=$pid=$sim=$bitScore=$expect=''; $gap=0;
$line=$bline;
chomp $line; @tmp=split(/,/o,$line);
push @ali_para,@tmp;
}
# 2nd: blast+
# Identities = 57/62 (91%), Positives = 59/62 (95%)
# Identities = 57/62 (91%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
if ( $bline=~ /Identities/){
$line=$bline; chomp $line;
@tmp=split(/,/o,$line); push @ali_para,@tmp;
foreach $param (@ali_para){
$param=~s/\s+//g;
if ($param=~/Score/){ $bitScore=$param; if( not $bitScore=~s/^.+=(.+)bits.*$/$1/o ){ confess($bitScore); } }
elsif ($param=~/Expect/){@temp=split(/=/,$param); $expect=$temp[1];}
elsif ($param=~/Identities/){$lali=$param; if( not $lali=~s/.+\/([0-9]+)\(([0-9]+)%\).*$/$1/o ){ confess( $lali ); }
$pid=$2;}
elsif ($param=~/Positives/){$sim=$param; if( not $sim=~s/^.+\(([0-9]+)%\).*$/$1/o ){ confess( $sim ); }}
elsif ($param=~/Gaps/){$gap=$param; if( not $gap=~s/^.+=([0-9]+)\/.*$/$1/o ){ confess($gap); }}
}
$lali=$lali-$gap;
$qLength=$queryLength;
$rdb_lines{$id}{$Score_count}=[$qLength,$len2,$lali,$pid,$sim,$gap,$bitScore,$expect,$protDspt];
}
}
#-----------------------------------------------------------------------------------------------------
# lkajan: below is probably a blast bug, with the Query: 0 line...
# 0 1 2
# Query: 0 ----
#
# Sbjct: 64 PAQG 67
# Query: 0
#
# Sbjct: 67 67
# Query: 1713 HVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRVSI 1772
# Query: 1890 PGTPTQQPSTPQT 1902
# blast
#Query: 1 MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSC 60
# MDP EC CMSGGIC+CGDNCKCTTCNCKTCRKSCCPCCPPGCAKCA+GCICKGGSDKCSC
#Sbjct: 1 MDPGECTCMSGGICICGDNCKCTTCNCKTCRKSCCPCCPPGCAKCAQGCICKGGSDKCSC 60
# blast+
#Query 1 MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSC 60
# MDP EC CMSGGIC+CGDNCKCTTCNCKTCRKSCCPCCPPGCAKCA+GCICKGGSDKCSC
#Sbjct 1 MDPGECTCMSGGICICGDNCKCTTCNCKTCRKSCCPCCPPGCAKCAQGCICKGGSDKCSC 60
# lkajan: do not confuse with 'Query= MT4_HUMAN' - this may appear in blast+ after each round header
if($bline=~/^Query:?\s+\d+/o)
{
@tmp=split(/\s+/o,$bline);
if( $tmp[1] != 0 )
{
$bug_query = 0;
undef @aligned; undef @inserted_query;
$beg=$tmp[1]-1; $end=$tmp[3]-1;
if (! defined $endings{$Score_count}[0] || $endings{$Score_count}[0] < 0 ){ $endings{$Score_count}[0]=$beg;}
$endings{$Score_count}[1]=$end;
@inserted_query=split(//o,$tmp[2]);
}
else
{
$bug_query = 1;
}
}
if( !$bug_query && $bline =~ /^Sbjct/o ){
@tmp=split(/\s+/o,$bline);
@aligned=split(//o,$tmp[2]);
#getting rid of insertions at query sequence
cluck( " *** ERROR sbr: blastp_to_saf in lenghts for $id" ) if ($#inserted_query != $#aligned);
$local_counter=0;
undef @tmp_seq;
for($it=0;$it <= $#inserted_query; $it++){
if ($inserted_query[$it] =~ /[a-z_A-Z]/){
$tmp_seq[$local_counter]=$aligned[$it];
$local_counter++;
}
}
#@aligned=@tmp_seq; #-------------------------------------------
#+++++++++++=
@block_seq[$beg .. ($beg+$#tmp_seq)]=@tmp_seq; #----alignig part of the subject seguence
$multi_aligned{$Score_count}=[ @block_seq ];
}
}
close $fhin;
@alignedids = sort{ $a cmp $b }@alignedids;
#getting rid of repeats in the list
undef @namesSort;
push @namesSort, $queryName;
# $Lname=$queryName; $Lname=~tr/A-Z/a-z/;
# $Cname=$Lname; $Cname=~tr/a-z/A-Z/;
# foreach $it (@alignedids){
# $rflag=0; @tmp=split(/\|/,$it);
# if( $it eq $queryName || $it eq $Lname || $it eq $Cname){ $rflag=1;}
# else {
# foreach $elem (@tmp){
# if($elem eq $queryName || $elem eq $Lname || $elem eq $Cname){$rflag=1;}
# }
# }
# if($rflag == 0){push @namesSort, $it;}
# }
push @namesSort, @alignedids;
@namesSort = List::MoreUtils::uniq( @namesSort );
@alignedNames = splice( @namesSort, 1 );
if( $debug ){ warn( Data::Dumper::Dumper( \@alignedNames ) ); }
#-------------------------------------
#--filtering alignment
if($filter != 100){
($Lok,$msg)=&saf_filter(\@alignedNames,\%sequences,$filter,$maxAli);
return(0,"*** ERROR $sbr : $msg") if(! $Lok );
}
#----------------------------------- printing out the resulting files
if ($rdb ne '0' ){
foreach $id (@alignedNames){
$identifier=$id;
foreach $score (sort keys %{ $rdb_lines{$id} }){
#if($score > 1){ foreach $it ( @{ $rdb_lines{$id}{$score} }){$it='!'.$it;} };
($qLength,$len2,$lali,$pid,$sim,$gap,$bitScore,$expect,$protDspt)= @{ $rdb_lines{$id}{$score} };
if($score > 1){ $expect='!'.$expect;
$protDspt='!'.$protDspt;
$identifier='!'.$identifier;
}
print FHRDB "$identifier\t$len2\t$pid\t$sim\t$lali\t$gap\t$bitScore\t$expect\t$protDspt\n";
}
}
}
#~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ short naming format
# undef %short_alignedNames;
# foreach $key (@alignedNames){
# if($key =~ /trembl/ || $key =~/swiss/){
# @tmp=split(/\|/,$key); $short=$tmp[2];
# }
# else { $short=$key;}
# $short_alignedNames{$key}=$short;
# }
#~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
($Lok,$msg)=&print_saf_file($queryName,$queryLength,\%sequences,\@alignedNames,@query);
return (0,"*** ERROR $sbr : $msg") if ( ! $Lok );
return (2,"*** WARNIG $sbr : no hits found after filtering") if ( $#alignedNames < 0);
if (-e $fileout) { return (1,"ok"); }
else { return (0,"*** ERROR $sbr : failed to produce the saf output file"); }
} # end of blastp_to_saf
#==============================================================================
sub saf_filter{
my $sbr='saf_filter';
my ($Lok,$msg);
local($array_name,$ali_hash,$red,$bound)=@_;
my @ord_ali_list=@$array_name;
my %alignment=%$ali_hash;
my @new_aligned_names=();
my ($count,$ct,$same);
@last= @query;
$len=$#last;
$count=0;
Floop:for($index=0; $index <= $#ord_ali_list; $index++){
if ( ! defined $alignment{$ord_ali_list[$index]}) { return(0,"*** ERROR $sbr : alignment to be filtered is not defined\n")}
@maybe=@{ $alignment{$ord_ali_list[$index]} };
$ct=$same=0;
foreach $itres (0..$len){
next if ($maybe[$itres] !~ /[a-zA-Z]/);
next if ( $last[$itres] !~ /[a-zA-Z]/);
++$same if ($maybe[$itres] eq $last[$itres]);
++ $ct;
}
if ( ( $ct > 0 && (100*$same/$ct)<$red ) || $ct==0 ){
@last=@maybe; $count++;
push @new_aligned_names, $ord_ali_list[$index];
last Floop if ($count >= $bound);
}
}
@$array_name=@new_aligned_names;
return(1,"filtering is done");
}
#==============================================================================================
#==============================================================================================
sub printRdbHeader{
my $sbr='printRdbHeader';
my ($Lok,$msg);
$header="
#PERL-RDB
#SEQLENGTH\t $queryLength
#ID\t:\tidentifier of the aligned (homologous) protein
#LSEQ2\t:\tlength of the entire sequence of the aligned protein
#LALI\t:\tlength of the alignment excluding insertions and deletions
#%IDE\t:\tpercent indentity
#%SIM\t:\tpercent similarity
#LGAP\t:\ttotal gap length
#BSCORE\t:\tblast score (bits)
#BEXPECT\t:\tblast expectation value
#PROTEIN\t:\tone-line description of aligned protein
#'!'\t:\tindicates lower scoring alignment that is combined with
#the higher scoring adjacent one
##ID\tLSEQ2\t%IDE\t%SIM\tLALI\tLGAP\tBSCORE\tBEXPECT\tPROTEIN\n";
open(FHRDB,">$rdbFile") || return(0, "*** ERROR $sbr : could not open rdbfile=$rdbFile for writing\n");
print FHRDB $header;
return( 1,'ok');
}
#==============================================================================================
#==============================================================================================
sub print_saf_file{
my $sbr='print_saf_file';
my ($Lok,$msg);
local($queryName,$queryLength,$alignment,$aliNames,@query)=@_;
my %sequences=%$alignment;
my @alignedNames=@$aliNames;
my ($fhout,$pages,$nameField);
$fhout="FHOUT";
$pages=int $queryLength/50;
if ($queryLength%50 != 0){$pages++;}
open($fhout,">", $fileout ) || return(0,"*** ERROR $sbr: failed to open fileout=$fileout for writing");
print $fhout "# SAF (Simple Alignment Format)\n";
print $fhout "#\n";
$nameField=0;
@tmp=split(//,$queryName);
if ($#tmp+2>$nameField){$nameField=$#tmp+2;}
foreach $key (@alignedNames){
@tmp=split(//,$key);
if ($#tmp+2>$nameField){$nameField=$#tmp+2;}
}
for($it=1;$it<=$pages;$it++){
$beg=($it-1)*50; $end=$it*50-1;
printf $fhout "%-${nameField}.${nameField}s", $queryName;
for($index=0;$index<50;$index=$index+10){
$first=$beg+$index; $last=$first+9;
if ($last <= $queryLength -1 ){print $fhout @query[$first .. $last]," " ;}
else { print $fhout @query[$first .. ($queryLength-1)]; }
}
print $fhout "\n";
foreach $key (@alignedNames){
printf $fhout "%-${nameField}.${nameField}s", $key;
for($index=0;$index<50;$index=$index+10){
$first=$beg+$index; $last=$first+9;
if ($last <= $queryLength -1 ){
print $fhout @{ $sequences{$key}}[$first .. $last]," " ;
}
else { print $fhout @{ $sequences{$key}}[$first .. ($queryLength-1)]," " ; }
}
print $fhout "\n";
}
print $fhout "\n";
}
close $fhout;
return (1,'ok');
}
#======================================================================
# vim:ai:ts=4:
|